KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5792Help
Entry
Rleg2_5792        CDS       T00779                                 

Definition
hypothetical protein
Orthology
K02433  
aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:rlt00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pRLG202:complement(202052..203422)
Genome map
AA seq 456 aa AA seqDB search
MSKSFGAMSVAQLSVLIQGGAADPVDVAAAVFGAIADYADKAVFTTLTESRAMAEARASS
KRLREGRSLGLLDGIPIAWKDLFDIEGLATTAGSVVLAADAPAKRDAAVVGFLRQAGMVA
IGRTNMSEFAFSGLGINPHYGTPVNPRGNDLPRIPGGSSSGAGVAVAAGLVPVAMGTDTG
GSVRIPAAFNGIVGYKATRGRHAMDGVYPLARSLDSLGPFCRGVKDAVWIDAAMRGRIAP
DVVERPLQALELLVPENIVFDGAEPGVIAAFEAGLERLQRAGVHVARAVIPAFDAIFDLM
TRYGPLVTAEAFALHHERLAGPDADRMDHRVVMRTRLGSRTSLADYLAILEARKRMIADV
ERLVGDRLLAFPTVAHVAPPIGPLEGDDELFFATNNKTLRNTALGNFLDWCGVSIPCGTG
ASGMPVGLLLSATARRDETLLGVALAAEPVVRGDFA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaatccttcggcgcgatgtcggtcgcccagctttccgtccttattcaaggtggc
gcggccgatccggtcgatgtggccgcggcggtcttcggcgccatcgctgattacgccgac
aaggcggtcttcaccacgctgaccgaaagccgcgcgatggcggaggcgcgggcctcttcc
aaacgtttgcgggaaggccggtcactcggattgctggacggtattccgatcgcctggaag
gatcttttcgatatcgaaggcctggcgacgacggcgggatccgtcgtgctcgccgccgat
gcgccggccaagcgcgatgcggccgtcgtcggcttcctcaggcaggcgggcatggtcgct
atcggccgcaccaatatgagcgaatttgccttttccggcctcggcatcaacccgcattac
ggcacgccggtcaatccgcgcggcaacgatctcccgcgcattccgggcggctcctcctcc
ggcgccggtgtcgccgtcgcagccggcctggtgccggtggcgatgggcacggataccggc
ggctcggtacgtattcccgctgccttcaacggcatcgtcggctacaaggcgacccgcggc
cgtcatgcgatggacggcgtctatccgctggccaggagcctggattcgctagggccgttc
tgccgcggcgtcaaggatgcggtgtggatcgatgcggcgatgcgcggccggatcgcacct
gatgtcgtcgagcgtccgctgcaggcgttggaactgctcgtgcccgaaaatatcgtcttc
gacggagccgaaccgggcgtcatcgccgcattcgaggccggtttggaacggcttcaaagg
gccggcgtccatgttgcccgtgccgtcattcccgccttcgacgcgattttcgatctgatg
acgagatatggcccgctggtcaccgccgaagctttcgcgcttcaccatgaacgcttggcg
ggaccggatgcggacaggatggaccaccgcgtcgtcatgcgcacccgcctgggaagcagg
acgagcctggccgattacctggcgatcctcgaggcgcgcaaacggatgatcgccgatgtc
gagcgccttgtcggcgaccggctgctcgcctttccgacggtcgcccatgtcgcgccgccg
atcggaccgctggaaggggacgacgaactgttcttcgcgaccaacaacaagacgctgcgc
aacaccgcgctcggcaatttcctcgactggtgtggggtctccatcccctgcggcacgggt
gcctcaggcatgccggtcggcctgctgctctcggccaccgcccgtcgcgacgaaacgctg
ctgggagttgcccttgccgccgagccggtcgtccgcggcgatttcgcctga

DBGET integrated database retrieval system