KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5793Help
Entry
Rleg2_5793        CDS       T00779                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pRLG202:203661..203975
Genome map
AA seq 104 aa AA seqDB search
MTDCETLTRRQDMVTLHVKEDETTGLGERDYVEHVSAQKLSGFERIVVVAALALLSFVGF
AAYSSSETDPVTTSAIAAPAGDSAPHHQPYGHCRESSPYAERVC
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgacagattgtgaaactttgacccgtcgccaggatatggtgaccctccatgtgaaagag
gacgaaaccaccggcttgggcgagcgcgactatgtggaacatgtcagcgcccagaaactt
tcgggcttcgagcgcattgtcgtggtcgccgcgctggctctcttgagcttcgtcggtttc
gccgcatattcttccagtgagacggacccggtgacgacatcggccatcgctgcccccgct
ggcgacagcgcaccgcaccaccagccttacggccattgccgtgagagcagcccgtatgct
gaaagggtctgctga

DBGET integrated database retrieval system