KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5804Help
Entry
Rleg2_5804        CDS       T00779                                 

Definition
(GenBank) RNA polymerase, sigma-24 subunit, ECF subfamily
  KO
K03088  
RNA polymerase sigma-70 factor, ECF subfamily
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Brite
Transcription machinery [BR:rlt03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     Rleg2_5804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pRLG202:complement(213669..214538)
Genome map
AA seq 289 aa AA seqDB search
MNEKKWLADQFEANRAHLRAAAYRMLGSRSEAEDAVQEAWLRLNRADTTDIGNLGGWLTT
VVARICLDMLRARKTRREQPLEMPVHAAIADPAHDPERDAAFAESVGVALLVVLQTLAPA
ERVAFVLHDMFDLPFDEIAPIIGRTSAAARQLASRARRRVQGTDEAPDVDFGRKRTIAEA
FLTASRIGDLEALLAVLAPDVVFRPDATAARFGPFGGRRGASEVAELFKGRAQAAEAALV
DGEVGFIVRIKGELRVVVTLTIVDGKVTVIEAFADPDYLEHVDYSVLSS
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaaaaaatggctggccgatcaattcgaggcgaaccgggcgcatctgcgggcg
gcggcctatcgcatgctcggctcgcgcagcgaggctgaagacgccgtccaggaggcctgg
ctgcggctcaaccgcgcggatacgactgacatcggcaatctcggcggctggctgacgacg
gtggtggcgcgcatctgcctcgacatgctgcgggcccgcaagacccggcgcgagcagccg
ctggagatgccggtccatgccgcgattgccgatccggcacatgatccggagcgcgatgcg
gccttcgccgaatcggtcggcgtggccttgctcgtcgtgctgcagacgctggcgccggcc
gagcgggtcgccttcgtgctgcatgacatgttcgatctgccttttgacgagatcgcgccg
atcatcggccgcacgtccgccgccgcccggcagctcgcaagccgcgcccgccgccgcgtg
cagggcacggacgaggcgcccgatgttgatttcggccgcaagcggacgatcgcggaagcc
ttcctgacggcatcgcgcatcggcgatctcgaggccttgcttgccgtgcttgctcccgat
gtcgtcttccggccggatgcgacggcagcgcgattcggtccatttggcggaaggcgcggc
gcgtccgaggtcgcagagctgttcaagggccgggcacaggcggcggaagccgcgctcgtc
gacggcgaagtcggattcatcgtccgcatcaagggcgaactgcgcgtcgtcgtgacgctg
accatcgtcgatgggaaggtgacggtgatcgaagccttcgccgatccggattatctcgaa
cacgtcgactattccgtgctttccagctga

DBGET integrated database retrieval system