KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5808Help
Entry
Rleg2_5808        CDS       T00779                                 

Definition
(GenBank) transcriptional regulator, DeoR family
  KO
K03477  
DeoR family transcriptional regulator, ulaG and ulaABCDEF operon transcriptional repressor
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Brite
Transcription factors [BR:rlt03000]
 Prokaryotic Type
  Helix-turn-helix
   DeoR family
    Rleg2_5808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pRLG202:218975..219787
Genome map
AA seq 270 aa AA seqDB search
MHERERHRIILSAVQEKSVVTIQDIAELTEASEATIRRDIAALHVQGKIRRVRGGAEAVH
PPQLGNLAGRPFRVSESVNIDKKRAIARAAVDLCEAGDAIIINGGTTTFQMVHYMAGHRL
QVMTNSFAIAEHLVKHSKNTVTVPGGAIYREQSLILSPFDNDAIRNFYARRMFIGAQGVG
PLGIMEADALIIQSEQKLMHQADELVVMVDSSKFNRRSSLILCALDRVSVVITDDGISDE
AARMIENAGVRLVVASPVAQAVREDSSSVA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaacgcgaacgccatcgcatcatcttaagcgctgttcaggaaaagtccgtggtg
acgatccaggacattgccgagctgacggaagcttccgaagcgacaatccggcgcgacatt
gcggctcttcatgtgcagggcaagatccgtcgcgtccgcggcggcgccgaagcggtgcat
ccgccgcagctcggcaatcttgccggccggcccttccgggtttcagaatcagtcaacatc
gataaaaaacgtgcaattgcccgcgcagccgtcgatctctgcgaagcgggcgatgccatc
atcatcaatggcggcacgacgaccttccagatggtgcattacatggccggccatcgcctg
caggtgatgaccaattcttttgccatcgccgaacatctggtcaaacattccaaaaacacg
gtgacagtgccgggcggcgcgatctatcgcgagcagagcctgatcctgtcgcctttcgac
aatgacgcgatccgcaatttttatgcgcggcgcatgttcatcggcgcccagggcgtcggc
ccgctcggcatcatggaggcggatgccctgatcatccagagcgagcagaagctgatgcac
caggccgacgaactcgtcgtcatggtcgattcaagcaaattcaatcgccggtcgagcctc
attctctgtgcgctcgaccgcgtttctgtggtcatcaccgatgacgggatttcggacgag
gcggctcgcatgatcgagaatgccggcgtccggctcgttgtcgcaagcccggtggcccag
gctgtgagggaggattcctcgtcggtcgcatga

DBGET integrated database retrieval system