KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5809Help
Entry
Rleg2_5809        CDS       T00779                                 

Definition
(GenBank) rhamnose ABC transporter, periplasmic rhamnose-binding protein
  KO
K10559  
rhamnose transport system substrate-binding protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
ABC transporters
Module
Rhamnose transport system
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Rleg2_5809
Transporters [BR:rlt02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Rhamnose transporter [MD:M00220] [OT]
    Rleg2_5809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pRLG202:219834..220829
Genome map
AA seq 331 aa AA seqDB search
MKLAKTLALGVALAVAMMAGTASAKDIKIGLVVKSLGNGFFDAANKGAQEAAKELGGVEV
IYTGPTSTTAEGQIEVINSLIAQGVDAIAVSANDPDALVPALKKATQRGIKVISWDSGVA
PEGRILQLNPSSNELIGKMCLTLVKDHLDGGKGDFAILSATTTSTNQNIWIDQMKKQLKD
FPGLNLVTTVYGDDLSDKSYREAEGLLKSNPNVKVIVAPTTVGVLAASKVVEDKGLVGKV
YVTGLGLPSEMAGAIKSGATKEFAIWNPIDLGYSATQIAYRLVKGETDGKPGSEIAAGRM
GKIKVGDNSEAAMADPFVYNASNIDEFSKVF
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgcaaagacacttgcgctcggcgtcgcgctcgccgtcgccatgatggccggc
accgccagcgccaaggacatcaagatcggcctcgtcgtgaagtcgctcggcaacggcttc
ttcgacgccgccaacaagggcgcccaggaagccgcaaaggaactgggcggcgttgaggtc
atctataccggcccgacgtcgacgacggccgaaggccagatcgaagtcatcaactcgctg
atcgcccagggcgtcgacgccatcgccgtctcggccaacgatccggacgcgctcgtcccg
gcgctgaagaaggcgacccagcgtggcatcaaggtcatctcctgggattccggcgttgcg
ccggaaggccgtatcctgcagctcaacccctcgtccaacgagctgatcggcaaaatgtgc
ctgacgctggtcaaggatcatctcgacggcggcaagggcgacttcgccatcctgtcggca
accaccacctcgaccaaccagaacatctggatcgaccagatgaagaagcagctcaaggat
ttcccgggtctcaacctcgtcaccacggtttacggcgacgacctctcggacaagtcctac
cgtgaagccgaaggcctgctgaagtcgaacccgaacgtcaaggtcatcgtcgctccgacg
acggtcggcgttctcgccgcttccaaggttgtcgaagacaagggccttgtcggcaaggtc
tacgtcaccggcctcggcctgccgtccgaaatggccggcgcgatcaagtcgggcgcgacg
aaggaattcgccatctggaacccgatcgacctcggctattccgcaacccagatcgcctat
cgcctcgtcaagggtgagaccgatggcaagccgggcagcgaaattgccgccggccgcatg
ggcaagatcaaggtcggcgacaatagcgaagccgccatggccgatcccttcgtctacaat
gcttcgaacatcgacgagttctccaaggtcttctga

DBGET integrated database retrieval system