KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5812Help
Entry
Rleg2_5812        CDS       T00779                                 

Definition
(GenBank) Monosaccharide-transporting ATPase
  KO
K10561  
rhamnose transport system permease protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
ABC transporters
Module
Rhamnose transport system
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Rleg2_5812
Transporters [BR:rlt02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Rhamnose transporter [MD:M00220] [OT]
    Rleg2_5812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pRLG202:223461..224468
Genome map
AA seq 335 aa AA seqDB search
MSTVSTPEKRVIPDRLGTPLRRIVASWEVLLFGVAVLIFIFNSLASPYFLDAWNLSDATF
NFTEKAMIAFAMALLVISGEIDLSVAAIIALASTAMGAAAQFGIGTPGLVLIGIGTGLVC
GIFNGVLVSVLKLPSIVVTIGTMSLFRGISYIVLGDQAYGKYPADFAYFGQGYVVWVFSF
EFVLFIVLAILFAILLHATNFGRQVYAIGNNDFAARFSGIPVERVKFILFLLTGIMSGIA
AVCLTSRLGSTRPSIAQGWELEVVTMVVLGGISILGGSGTIGGVVIAAFVMGLVTFGLGL
LNVPGIVMSIFIGLLLIITIAIPIIARRIKLMSSR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgtgtccacacctgagaagcgggtcatccccgatcgcctcggcacgccgttg
cgccgcatcgtcgccagctgggaagtgctgctctttggcgtcgccgtcctgatcttcatc
ttcaactccctggcctcgccctatttcctcgatgcctggaacctctccgacgccaccttc
aacttcaccgaaaaggcgatgatcgccttcgccatggcactgctcgtcatctcaggcgag
atcgacctgtcggtcgctgcgatcattgcgctcgcctcgacggcgatgggagcggcagcc
cagttcggcatcggcacgccgggcctggtgctgatcggcatcggcaccggcctggtctgc
ggcatcttcaacggcgtcctggtctcggtgctgaaactgccgtcgatcgtcgtcaccatc
ggcacgatgagccttttccgcggcatttcctatatcgtgctcggcgatcaggcctatggc
aaatatcccgccgacttcgcctatttcggccagggttacgtcgtctgggtgttctccttc
gaattcgtgctgttcatcgtgctggcgatcctcttcgccatcctgctccatgcgacgaat
ttcggccggcaggtctatgcgatcggcaataacgacttcgccgcccgcttctccggcatc
ccggtcgagcgcgtcaaattcatcctcttcctgctgaccggcatcatgagcggcatcgcc
gccgtctgcctgacctcgcgcctcggctcgacccggccgtcgatcgcccaaggctgggag
ctcgaggtcgtcaccatggtcgtgctcggcggcatctcgatcctcggcggctccggcacg
atcggcggcgtcgtcatcgccgccttcgtcatgggcctcgtcaccttcggcctcggcctg
ttgaacgtgcccggcatcgtcatgtcgatcttcatcggcctgctcctgatcatcaccatc
gccatcccgatcatcgcccgccgcatcaagctcatgagttcccgatga

DBGET integrated database retrieval system