KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5821Help
Entry
Rleg2_5821        CDS       T00779                                 

Definition
(GenBank) ABC transporter related
  KO
K01996  
branched-chain amino acid transport system ATP-binding protein
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
ABC transporters
Quorum sensing
Module
Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Rleg2_5821
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Rleg2_5821
Transporters [BR:rlt02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    Rleg2_5821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pRLG202:complement(232375..233076)
Genome map
AA seq 233 aa AA seqDB search
MAALLEIQGLNAWYGESHVLHGVDMRVAEGETITILGRNGVGKTTTLRTITGIVRARKGR
ISFAGSDMMQVPLHKTAHRGIGFVPEERGIFSTLTVSENLLLPPVVAKGGMTLDEIYELF
PNLYERRGSPGTKLSGGEQQMLAIARILRTGVRLLILDEPTEGLAPVIVQRIGEVLQTLK
GRGMTILLVEQNFRFASRIADRFYLMDHGQMVSEFPVGELPQRMDTLHKVLGV
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggccgctctcctcgaaattcagggactgaacgcctggtacggcgaaagccatgtcctg
cacggcgtcgacatgcgggtggccgaaggcgagacgatcaccattctcggccgcaacggc
gtcggcaagacgacgacgctgcgcaccatcaccggcatcgtgcgggcccgcaagggcagg
atcagctttgccggcagcgacatgatgcaggtgccgctgcacaagacggcgcatcgcggc
atcggcttcgtgcccgaggagcgcggcatcttctcgacgctcaccgtgtccgaaaacctg
ctgctgccgcctgtcgtggcaaagggcggcatgacgctcgacgagatctacgagcttttc
cccaatctctacgagcgccgcggcagcccgggcaccaaactatcaggcggcgagcagcaa
atgctggcgatcgcccggatcctgcgcaccggcgtccggttgctcattctcgacgaaccg
acggaagggcttgccccggtcatcgtccagcgcatcggcgaggtgctgcagaccctgaaa
ggacgcggcatgacgatcctgctcgtcgagcagaacttccgtttcgccagccgtattgcc
gatcgcttttatctgatggatcatgggcagatggtgtcggaattcccggtcggcgaactg
ccgcagcgcatggatacgctgcacaaggttctgggagtatga

DBGET integrated database retrieval system