KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5824Help
Entry
Rleg2_5824        CDS       T00779                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pRLG202:235245..236198
Genome map
AA seq 317 aa AA seqDB search
MNNPPQFTWDDLQFFLAVARTGQLSTAARQLRSSHATVSRRIDRLEFTLKVKLFERNPRG
YVLTAMGTRFVETAERMEQETERLRADLADGSMAQRGLVRLSAPEGFANFFFATVLPRFA
AQHPHLSLELVTIQQIMSLSRKEADLSVVLDEPKGGPYFAERLTDYHLQIYGSRDYLAKA
PVITCRDDLLEHPFVSYIEEMIFAPGLDYLSDVHPRIKPQFQSSSIFAQLTATRNGLGLC
ILPYFFASRYPELVRVLPAEIDLKRHYWITCHRDLKQAPRVRAVIDFLREAVRGEDARFV
PPYVTPAGPARRAEADI
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatccgccgcagtttacttgggacgatcttcagttttttctagccgtcgcccgc
actggacagctgtcgacggcggcccgccagctgcgctccagccatgcaaccgtctcgcgc
cgcatcgaccggctggaattcaccctcaaggtcaagctcttcgagcgcaatccgcgcggc
tacgtgctgaccgccatggggacgcgcttcgtcgagacggccgagcggatggagcaggaa
accgagcggctgcgcgccgatctcgccgacggttcgatggcgcagcgcggcctggtgcgg
ctgagcgcaccggaaggttttgccaatttcttcttcgccaccgtgctgccgcggtttgcc
gcccagcatccgcatctctcgctcgagctggtgacgatccagcagatcatgtcgctgtcg
cgcaaggaggccgatctttccgtcgtgctcgacgagccgaagggcggaccctatttcgcc
gagaggctcaccgactaccatctgcagatctacggctcacgcgactatctggcgaaggcg
cctgtcatcacctgccgcgatgatctgctcgagcaccccttcgtcagctatatcgaggaa
atgattttcgcgccgggcctcgattatctcagcgacgtgcatccgcgcatcaaaccgcag
ttccagagctccagcatcttcgcccagctgaccgccacccgaaacggcctcggcctctgc
atcctgccctactttttcgccagccgttatcccgagctcgtgagggtgctgcccgcggaa
atcgacctcaagcgccactactggatcacctgccaccgcgacctgaaacaggcgccgcgg
gtgcgcgccgtcatcgacttcctgcgtgaggccgtgcgcggcgaggacgcccgcttcgtg
ccgccctatgtcacgccagccggcccggcacgccgggcggaggctgatatctaa

DBGET integrated database retrieval system