KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5888Help
Entry
Rleg2_5888        CDS       T00779                                 

Definition
Di-haem cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Brite
Enzymes [BR:rlt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Rleg2_5888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pRLG202:297424..298713
Genome map
AA seq 429 aa AA seqDB search
MTTKIIWLARTGLAVGIGAAALCLAILPLRQSSAAVAFGVHPGPMSRAAAFARAETLTAL
GRKIFSDASLSASGLQACASCHDPAHAFGPTSAKPVEMGGKDMNQPGLRAVPTLRYLQAV
PSFSEHFYDSEDEGDESVDNGPTGGLTWDGRVDHGADQAKIPLLSPFEMGNKNAADVAAK
LRKAPYADAIKAAFGAAVFDNPEDTFNAAAEALATFEQSGPDFYPYSSRYDAFLAGKATL
TTQELHGRQLFEDPAKGNCSSCHLSELANDGEPPQFSDFGFLGLAAPRNMAISANSDPNY
HDLGLCGPKRTDLAGHAEYCGLFRTPTLRNVALKKSFFHNGYFHTLRDVVSFYATRDSDP
GRWYPKKADGTIHKYDDLPEAYWDNLNPDPPFGRKPGDAPALTDPEIDDIVAFLDTLTDA
DLQPEMNGH
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgaaaatcatctggcttgcgcgcaccggtctggccgtcggtatcggtgcggca
gcgctctgtctggccattctgcccctgcggcaaagcagcgcggcggtggctttcggcgtg
catcccggcccgatgtcgcgcgctgcggccttcgcccgggccgaaacgttgaccgcgctc
ggccgcaagatattctcagacgcctcgctgtcggcctcggggctgcaggcctgcgcctcc
tgccatgatcccgctcacgccttcggcccgacatcggccaaaccggtcgagatgggcggc
aaggacatgaaccagccgggcctgcgcgccgtgccgacgctacggtatctgcaggcggtt
ccctccttcagcgagcatttttacgattccgaggacgagggcgacgaaagcgtcgacaat
ggcccgaccggcggcctgacctgggacggccgcgtcgatcacggcgccgaccaggcaaag
attccgctgctctcgcccttcgagatgggcaacaagaatgcggccgatgtggcggccaag
ctgcgcaaggcgccctatgccgacgccatcaaggcggccttcggcgcggcggtgttcgac
aatccggaggatactttcaacgccgccgccgaggcgctcgccaccttcgagcaaagcggc
ccggatttttatccctattccagccgctacgacgccttcctcgccggcaaggcgacgctg
acgacgcaggaattgcacggacgtcagctgttcgaggatcccgcaaagggcaactgttcg
agctgccacttaagcgaactcgccaatgacggcgagccgccgcaattttccgatttcggc
ttcctcggcctcgccgccccccgcaacatggcgatctcggccaacagcgacccgaactat
cacgatctcggcctctgcggcccgaagcggaccgaccttgccggacacgccgaatattgc
ggcctgttccgcacgccgacgctgcgcaatgtcgcgctgaagaagagcttcttccacaat
ggctatttccacacgctgcgcgacgtcgtctccttctacgccacccgcgacagcgacccc
ggccgctggtatcccaagaaagccgacggcacgatccacaaatacgacgacctgcctgag
gcctattgggacaacctcaacccggacccgcccttcggccggaagccgggcgatgcccct
gccctcaccgaccccgaaatcgacgacatcgtcgccttcctggacacgctgacggatgcc
gatctgcagcctgagatgaatgggcattaa

DBGET integrated database retrieval system