KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_5908Help
Entry
Rleg2_5908        CDS       T00779                                 

Definition
glycoside hydrolase family 4
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Rleg2_5908
  Lipid metabolism
   00561 Glycerolipid metabolism
    Rleg2_5908
   00600 Sphingolipid metabolism
    Rleg2_5908
Enzymes [BR:rlt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Rleg2_5908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pRLG202:complement(326462..327928)
Genome map
AA seq 488 aa AA seqDB search
MSFKIAIIGAGSVGFTKKLFTDILCVPEFRDVEFALTDLSEHNLEMIKAILDRIVEANGL
PTKVTATTDRRQALTGARYIISCVRVGGLEAYADDIRIPLKYGIDQCVGDTICAGGILYG
QRNIPVILDFCKDIREVAEPGAKFLNYANPMAMNTWAAIEYGKVDTVGLCHGVQHGAEQI
AEVLGAKSLGELDYVCSGINHQTWFIDLRLNGRRIGKDELIAAFEAHPVYSQQEKLRIDV
LKRFGVYSTESNGHLSEYLPWYRKRPEEITRWIDMSDWIHGETGGYLRHSTETRNWFETE
FPQFLESAAKPIDPAKRSNEHASHILEALETNRVYRGHFNVKNNGVITNLPSDAIIESPG
FVDRFGINMVSGVTLPEACAATCIASINVQRMSVHAAISGDIDLLKLAVLHDPLVGAVAT
PEEVWQMVDEMVVAQARWLPQYADAVPAAKERLSKSKVQTRDWAGAARRNVRSIEELRAE
KAALKQAV
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcaaaatcgctatcatcggtgcgggcagcgttggtttcaccaagaagctgttt
accgacattttgtgcgttccggagtttcgcgacgtcgaattcgcgctgaccgatctcagc
gaacataatctcgagatgatcaaggcgatcctcgaccggatcgtcgaggcgaacggattg
ccgaccaaggtgacggcgacgaccgaccggcgccaggcgctgaccggcgcgcgctacatc
atcagctgcgtccgggtcggcggcctcgaagcctatgccgacgatatcaggatcccgctg
aaatacggcatcgaccaatgcgtcggcgatacgatctgcgccggcggcatcctctatggc
cagcgcaacattccggtcatcctcgacttctgcaaggatatccgcgaggtcgccgagccc
ggcgcgaaattcctgaactatgccaatccgatggcgatgaacacctgggcggcgatcgaa
tacggcaaggtcgataccgtcggcctctgccacggcgtccagcacggcgccgaacagatc
gccgaggtgctcggcgccaagtcgctgggtgaactcgactatgtctgctccggcatcaac
caccagacctggttcatcgacctgcgcctcaacggccgcaggatcggcaaggacgaactc
atcgccgccttcgaggcgcatccggtctattcgcagcaggagaagctgcgcatcgatgtg
ctgaagcggttcggcgtctattccaccgagagcaacggccatctttcggaatacctgccc
tggtatcgcaagcggccggaggaaatcacccgctggatcgacatgtccgactggatccac
ggcgagaccggcggttacctccgccattccaccgaaacccgcaactggttcgagaccgaa
ttcccgcaattcctggaatccgccgcaaagccgatcgaccccgccaagcgctcgaacgaa
catgcgagccacatcctcgaggcgctggagacgaaccgggtctaccgcggccatttcaac
gtcaagaacaatggcgtcatcaccaacctgccgtccgatgcgatcatcgaatcgcccggc
ttcgtcgaccgcttcggcatcaacatggtctccggcgtcaccctgccggaagcctgtgcc
gccacctgcatcgcctcgatcaatgtccagcgcatgtcggtgcatgccgccatctccggc
gacatcgaccttctgaagcttgccgtgctgcacgacccgctggtcggcgccgtggcgaca
cccgaggaggtctggcagatggtcgacgagatggtcgttgcccaggcgcgctggctgccg
caatatgccgatgccgtgccggccgccaaggagcggctgtcgaaatccaaggtgcagacc
cgcgactgggcgggtgccgcacgccgcaacgttcgctcgatcgaagagctgcgcgcggaa
aaggcggcgctgaaacaggccgtctga

DBGET integrated database retrieval system