KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_6131Help
Entry
Rleg2_6131        CDS       T00779                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:rlt01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rlt00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rlt00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:rlt00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:rlt00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pRLG203:complement(64396..66069)
Genome map
AA seq 557 aa AA seqDB search
MNAQSVYAAVRVEELVATYGGKDLNVAAQLCDRHPADAIAHTIIREDLSASILTYGELRV
ESEKLADSFLKLGIERGDRIATLMGKSRAYLVTLLAIYRIGAVHVPLFTAFAPPAIQFRV
DSCKPKLVACDASQKAKLKTVEAESSSLSWQIMTTGEADEGELSFDKLAAEGRTGTPSVA
VGSDGAFIQIYTSGTTGKPKGVVVPAKALAAFHAYAEFALGLRPDDVFWNSADPGWGYGL
YFGVLATFCTGTPSILLCAGFSPELTLEVLSRFKVTNFTAAPTVYRSLLATGLVPPSTNL
RCASSAGEPLTPEVNAWSVDALGVLVHDHFGQTEAGMLVNNHHHPELKHPLKTGSMGLAM
PGWTPVILRLDQDAVAPAGEVGRLAFEISESPFAWFTGYVDEPVKSAEKFAGDGRWYLTG
DMAKMEEDGYIYFSSRDDDIIIMAGYRIGPFEVESVLATHPAVAESAVIAVPDAVRGEVL
EAAVVLSAGRKPDEALVKELQAHVKKGFAAHAYPRRIHFVESLPKTPSGKIQRFVVRQQA
RDGTLATLSIRGAVDAN
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctcaatcagtgtacgctgccgttcgagtggaagaactcgtcgctacatatggc
ggtaaggacctaaacgtcgcagcgcaactatgcgatcggcatccggcggacgccatcgct
catacgatcatacgggaagacctttcggcttcgatcctgacctacggcgaactgcgcgtc
gaatccgagaagctcgctgattcctttctcaagctggggatcgagcgcggcgaccggatt
gcgactttgatgggcaagagccgagcctacctggtgaccctcctggcgatctatcgcatt
ggcgccgtccatgtcccactttttacagctttcgcccctcctgccatccagttcagggtg
gattcatgcaaacccaagcttgttgcatgcgacgcgtctcagaaggcgaagctcaagacc
gtcgaagcggaaagctccagcctgtcttggcagatcatgacgacgggggaggcggacgaa
ggcgagctttccttcgacaagttggcggccgaagggcgtacgggaaccccgagcgtcgcg
gttggctcagatggagcttttatccagatctacacgtcgggcacgactggaaagccgaag
ggcgtcgtcgttccggccaaggccctagccgccttccatgcctacgcggaatttgcactt
ggccttcgtccggacgacgtcttctggaattccgctgaccccggctggggttatggattg
tatttcggagtgctcgcgacattctgcaccgggacgccgtccatattgctctgcgcaggc
ttctccccggaactcacgttggaagtgctgtcgcggttcaaggtcacgaacttcacggcc
gcaccgacggtctaccggtcgctcctcgctacagggttggttcctccgtcgaccaacctc
cggtgcgcgagcagcgcgggcgagccgctaacgcctgaggtgaacgcgtggagcgtcgac
gctttgggcgtccttgtccacgaccacttcggccagaccgaagcgggaatgctcgtcaac
aaccatcaccacccggaattgaagcacccgctcaagacaggctctatggggttggccatg
ccgggctggacgccagtcatcctgcgcttggaccaagacgcggtcgctccagctggagaa
gtcgggcgtctcgccttcgaaatcagcgagagcccctttgcctggtttacgggatacgtc
gacgagcctgtcaaatcagccgagaagttcgcgggcgacggccgctggtacctcaccggc
gacatggcgaagatggaagaggacggctacatctacttcagctctcgtgatgatgacatc
attatcatggccggatatcgcatcggaccgttcgaggtcgaatccgttcttgccacgcat
ccggcagtggctgaatctgcggttatagcggtccccgacgccgtgcgtggcgaggttctg
gaggcggccgtcgtactcagcgcaggccgtaagcccgatgaagccttggtgaaggaactc
caggcgcacgtgaagaaaggattcgcagcacatgcctacccgcgcaggatccatttcgta
gaaagcctgcctaagacgccgtccggaaagatccagcgcttcgtggtgcggcagcaggca
agggacggaacgcttgcgacgttgagcattaggggagcagtcgatgcaaattaa

DBGET integrated database retrieval system