KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_6137Help
Entry
Rleg2_6137        CDS       T00779                                 

Definition
carbamoyl-phosphate synthase L chain ATP-binding
Orthology
K01965  
propionyl-CoA carboxylase alpha chain [EC:6.4.1.3]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rleg2_6137
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rleg2_6137
   00640 Propanoate metabolism
    Rleg2_6137
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rleg2_6137
Enzymes [BR:rlt01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.3  propionyl-CoA carboxylase
     Rleg2_6137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pRLG203:complement(72128..74131)
Genome map
AA seq 667 aa AA seqDB search
MFKKILIANRGEIACRVIKTAKKMGIATVAVYSDADAEALHVRMADEAVHIGAAPSSQSY
IVIDKILDAIHRTGADAVHPGYGFLSENSAFAEALEKAGIAFIGPPVRAIQAMGDKITSK
KIAAEAGVSTVPGHMGLIEDAEEAVRISASIGYPVMIKASAGGGGKGMRIAWNDAEAREG
FQSSRNEAKNAFGDDRIFIEKFVDQPRHIEIQVLGDQHGTALYLGERECSIQRRNQKVIE
EAPSPFLDAETRRAMGEQAVALAKAVGYFSAGTVEFIVDGARNFYFLEMNTRLQVEHPVT
ELVTSIDLVEQMIRVASGEKLSFAQDDVRLDGWAIESRLYAEDPYRNFLPSIGRLTRYRP
PAEGRQDDGTVIRNDTGVFEGGEISMYYDPMIAKLCTWAPDRLAAIDAMGKALDDFEVDG
IGHNLPFLSAVMDHDRFRSGKITTAFIAEEFPEGFSGVHPDEAAARKLAAIAVLAHQALQ
ERAVQISGTIGNHRRIVGRQWVATLAGFEEAVTLETGPDGAGVRFADGTQLSVASAWLPG
QCHARFHVGGAVMGVKINLVGSAIRLRWRGMDVTARVRSPRVAELARLMPKKLPPDTSKM
LLCPMPGVITSVSVKAGDAVEAGQTLATVEAMKMENVLKAERRGIVKHVAASEGQSLAVD
ELIMEFE
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagaaaatcctcatcgccaaccgtggcgagatcgcctgccgggtcatcaagacc
gcaaagaagatgggcattgcgacggttgccgtctattccgatgcggatgcagaagcgctg
catgtgcggatggccgacgaagctgttcatatcggcgcggcgccgtcttcccagtcctat
atcgtcatcgacaagatactggacgccatccaccgaaccggcgccgatgcggtccacccg
ggttacggcttcctgtcggaaaattccgccttcgccgaagcgctggaaaaggccggcatc
gccttcatcgggccaccggtgagggccatccaggcgatgggcgacaagatcacctcgaag
aagattgccgccgaagccggcgtctccaccgtgcccggccatatgggcctgatcgaggat
gccgaggaagcggtgaggatctccgcctcgatcgggtacccggtgatgatcaaggcatcc
gccggcggcggcggcaagggcatgcgcattgcctggaacgacgccgaggcgcgcgagggc
ttccagtcctcccgcaacgaggcgaagaacgcgttcggcgacgaccgcatcttcatcgaa
aaattcgtcgaccagccgcgccatatcgaaatccaggttctcggcgaccagcacggcaca
gcgctctatctcggtgagcgcgaatgctcgatccaacgccgcaaccagaaggttatcgag
gaggcgccgtcgcccttcctcgacgccgaaaccaggcgggccatgggagagcaagccgtc
gcactcgcgaaagcggtcggttatttctcggccggcacggtggagttcattgtcgacggc
gccagaaatttctatttcctcgagatgaacacccgcctgcaggtggagcaccccgtcacc
gaactcgtcaccagcatcgatctcgtcgagcagatgatccgcgtcgcgtcaggcgaaaag
ctgtcgttcgctcaggacgacgtcaggctcgatggctgggcgatcgaaagccggctttat
gccgaggatccctaccgcaacttcctgccctcgatcggccggctgacccgctaccgccct
ccggcggagggccggcaggacgatggcaccgtgatccgcaacgatactggcgtcttcgag
ggcggcgagatctccatgtattacgacccgatgatcgccaagctctgcacttgggcgcct
gatcgtctggcggccatcgatgcgatgggcaaggcgctcgatgatttcgaggtggacggc
atcggacataatctgcccttcctctcagccgtgatggatcacgaccgttttcgctccgga
aagatcaccaccgccttcatcgcggaggaattcccggaaggcttttcgggcgtgcatccc
gacgaggcggccgcaaggaagctcgccgccatcgccgtcctggcccatcaggccctgcag
gagcgggcggtacagatttcgggcacaataggcaatcaccggcgcatcgtcggcaggcaa
tgggtcgcgacgctggccggcttcgaggaggccgtcacgctcgaaaccgggcctgacggc
gccggcgtccgctttgccgatggaacgcagctttccgtcgctagcgcctggctgccgggc
cagtgccatgcccgtttccatgtcggcggcgcggtgatgggggtcaagatcaacctcgtg
ggctctgccatccggctgcgctggcggggcatggacgtcaccgcccgcgtgcgttcgccg
cgcgtggctgaacttgctcgcctgatgccgaaaaaactgccgccggacacctcgaagatg
ctgctctgccccatgcccggcgtcatcacctccgtctcggtgaaagccggcgatgccgtc
gaagccggccagacgctcgcgaccgtcgaggcgatgaagatggaaaacgtgctgaaggct
gagcgcagaggcatcgtcaagcacgtcgccgcaagcgagggccaaagcctggcggtcgac
gagttaatcatggagttcgagtga

DBGET integrated database retrieval system