KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_6137Help
Entry
Rleg2_6137        CDS       T00779                                 

Definition
carbamoyl-phosphate synthase L chain ATP-binding
Orthology
K01965  
propionyl-CoA carboxylase alpha chain [EC:6.4.1.3]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rlt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rleg2_6137
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rleg2_6137
   00640 Propanoate metabolism
    Rleg2_6137
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rleg2_6137
Enzymes [BR:rlt01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.3  propionyl-CoA carboxylase
     Rleg2_6137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pRLG203:complement(72128..74131)
Genome map
AA seq 667 aa AA seqDB search
MFKKILIANRGEIACRVIKTAKKMGIATVAVYSDADAEALHVRMADEAVHIGAAPSSQSY
IVIDKILDAIHRTGADAVHPGYGFLSENSAFAEALEKAGIAFIGPPVRAIQAMGDKITSK
KIAAEAGVSTVPGHMGLIEDAEEAVRISASIGYPVMIKASAGGGGKGMRIAWNDAEAREG
FQSSRNEAKNAFGDDRIFIEKFVDQPRHIEIQVLGDQHGTALYLGERECSIQRRNQKVIE
EAPSPFLDAETRRAMGEQAVALAKAVGYFSAGTVEFIVDGARNFYFLEMNTRLQVEHPVT
ELVTSIDLVEQMIRVASGEKLSFAQDDVRLDGWAIESRLYAEDPYRNFLPSIGRLTRYRP
PAEGRQDDGTVIRNDTGVFEGGEISMYYDPMIAKLCTWAPDRLAAIDAMGKALDDFEVDG
IGHNLPFLSAVMDHDRFRSGKITTAFIAEEFPEGFSGVHPDEAAARKLAAIAVLAHQALQ
ERAVQISGTIGNHRRIVGRQWVATLAGFEEAVTLETGPDGAGVRFADGTQLSVASAWLPG
QCHARFHVGGAVMGVKINLVGSAIRLRWRGMDVTARVRSPRVAELARLMPKKLPPDTSKM
LLCPMPGVITSVSVKAGDAVEAGQTLATVEAMKMENVLKAERRGIVKHVAASEGQSLAVD
ELIMEFE
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagaaaatcctcatcgccaaccgtggcgagatcgcctgccgggtcatcaagacc
gcaaagaagatgggcattgcgacggttgccgtctattccgatgcggatgcagaagcgctg
catgtgcggatggccgacgaagctgttcatatcggcgcggcgccgtcttcccagtcctat
atcgtcatcgacaagatactggacgccatccaccgaaccggcgccgatgcggtccacccg
ggttacggcttcctgtcggaaaattccgccttcgccgaagcgctggaaaaggccggcatc
gccttcatcgggccaccggtgagggccatccaggcgatgggcgacaagatcacctcgaag
aagattgccgccgaagccggcgtctccaccgtgcccggccatatgggcctgatcgaggat
gccgaggaagcggtgaggatctccgcctcgatcgggtacccggtgatgatcaaggcatcc
gccggcggcggcggcaagggcatgcgcattgcctggaacgacgccgaggcgcgcgagggc
ttccagtcctcccgcaacgaggcgaagaacgcgttcggcgacgaccgcatcttcatcgaa
aaattcgtcgaccagccgcgccatatcgaaatccaggttctcggcgaccagcacggcaca
gcgctctatctcggtgagcgcgaatgctcgatccaacgccgcaaccagaaggttatcgag
gaggcgccgtcgcccttcctcgacgccgaaaccaggcgggccatgggagagcaagccgtc
gcactcgcgaaagcggtcggttatttctcggccggcacggtggagttcattgtcgacggc
gccagaaatttctatttcctcgagatgaacacccgcctgcaggtggagcaccccgtcacc
gaactcgtcaccagcatcgatctcgtcgagcagatgatccgcgtcgcgtcaggcgaaaag
ctgtcgttcgctcaggacgacgtcaggctcgatggctgggcgatcgaaagccggctttat
gccgaggatccctaccgcaacttcctgccctcgatcggccggctgacccgctaccgccct
ccggcggagggccggcaggacgatggcaccgtgatccgcaacgatactggcgtcttcgag
ggcggcgagatctccatgtattacgacccgatgatcgccaagctctgcacttgggcgcct
gatcgtctggcggccatcgatgcgatgggcaaggcgctcgatgatttcgaggtggacggc
atcggacataatctgcccttcctctcagccgtgatggatcacgaccgttttcgctccgga
aagatcaccaccgccttcatcgcggaggaattcccggaaggcttttcgggcgtgcatccc
gacgaggcggccgcaaggaagctcgccgccatcgccgtcctggcccatcaggccctgcag
gagcgggcggtacagatttcgggcacaataggcaatcaccggcgcatcgtcggcaggcaa
tgggtcgcgacgctggccggcttcgaggaggccgtcacgctcgaaaccgggcctgacggc
gccggcgtccgctttgccgatggaacgcagctttccgtcgctagcgcctggctgccgggc
cagtgccatgcccgtttccatgtcggcggcgcggtgatgggggtcaagatcaacctcgtg
ggctctgccatccggctgcgctggcggggcatggacgtcaccgcccgcgtgcgttcgccg
cgcgtggctgaacttgctcgcctgatgccgaaaaaactgccgccggacacctcgaagatg
ctgctctgccccatgcccggcgtcatcacctccgtctcggtgaaagccggcgatgccgtc
gaagccggccagacgctcgcgaccgtcgaggcgatgaagatggaaaacgtgctgaaggct
gagcgcagaggcatcgtcaagcacgtcgccgcaagcgagggccaaagcctggcggtcgac
gagttaatcatggagttcgagtga

DBGET integrated database retrieval system