KEGG   Rhizobium leguminosarum bv. trifolii WSM2304: Rleg2_6463Help
Entry
Rleg2_6463        CDS       T00779                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rlt  Rhizobium leguminosarum bv. trifolii WSM2304
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:rlt00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pRLG204:complement(127751..129253)
Genome map
AA seq 500 aa AA seqDB search
MSGYILSIDQGTTSSRAIIFDGRMKMAGSAQAEITQYYPQPGWVEHDATEIWQSVVDTVR
KAIADAGLEATAIAAIGITNQRETAVVWDRRSGAPLHRAIVWQDRRTAEMCESLKADGYE
KLFSAKTGLLLDPYFSGTKLRWLLDNVDGLRGKAEAGDVCFGTIDSWLIYNLTGGRVHAT
DATNASRTLLYNIDDGVWDEELLGILGIPAAMLPEVRECADDFGRVDQALFGAELPILGV
AGDQQAAAVGNACFEPGMMKSTYGTGCFALLNTGRDRVSSSNRMLTTIAYRLDGETTYAL
EGSIFIAGAAVQWLRDGLGIIGQASEAGVLAAKADPGQQVYIVPAFTGLGAPYWDPAARG
AIFGLTRNSGPAEFARAVLESVAYQTLDLLVAMKKDWGVNQLETVLRVDGGMAASDWTMQ
CLADMTGNPVDRSAIRETTALGAAWLAGSKAGIWPGRRDFAQAWACDRRFNPSMEESERQ
AKIIGWKNAVSRMISDASAG
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagcggctatattctttcaattgaccaaggcacgacgtcgtcgcgcgcgatcatcttc
gatggccgcatgaaaatggccggctcggcccaggctgagattacccaatattacccgcag
ccgggatgggtggagcatgacgccactgagatctggcagtccgtggtcgataccgtgcgc
aaggcgatcgccgatgccggtctcgaagccaccgccattgccgcgatcggcattaccaac
cagcgcgagacggcggttgtctgggaccgacggtcgggcgcgccgcttcaccgggcgatc
gtctggcaggacaggcgcacggccgaaatgtgcgagagcctgaaggccgacggatatgag
aagctgttcagcgccaagaccggcctgctgctcgacccctatttctccggaaccaagctg
cgctggctgctcgacaatgtcgacggcctgcgggggaaggcggaggcgggcgacgtctgc
ttcggcacgatcgacagctggctgatctacaatctgacgggcgggcgtgtgcacgccacc
gatgcgaccaacgcgtcgcgaacactgctttataatatcgacgacggtgtttgggacgag
gagcttctgggcattctcggcatcccggccgcgatgcttcccgaagtccgggaatgcgcc
gacgatttcggccgcgtcgaccaggcgctgttcggtgcggagcttccgatcctcggcgtc
gccggcgaccagcaggcggcggccgtgggcaatgcctgcttcgagcccggcatgatgaaa
tccacctatggcactggctgctttgccctgctgaacaccggcagggatcgtgtttcctcc
tccaaccggatgctgacgacgatcgcctacaggctcgatggcgagacgacctatgcgctc
gaaggctcgatcttcatcgccggtgccgccgtgcaatggttgcgcgacgggctcggcatc
atcggccaggcgtcggaggcgggcgtactggccgccaaagccgaccccgggcagcaggtc
tatatcgtccccgccttcaccggcctcggtgcgccctactgggatccggccgcgcgcggc
gcgatcttcggcctgacgcgaaacagcggaccggcggaattcgctcgcgccgtgctcgaa
tccgtcgcctaccagacactcgacctgctggtggcgatgaagaaggactggggcgtcaac
cagctggaaaccgtgctgcgcgtcgatggcggcatggcggcttcggattggacgatgcag
tgcctggccgacatgaccggaaatcccgtcgaccggtcggcgatccgcgagacgacggcg
ctgggtgccgcctggcttgccggctcgaaagccggcatctggcccggcagacgggatttt
gcgcaggcctgggcctgcgaccgccgcttcaacccctcaatggaggagagcgaacggcag
gccaagatcatcggctggaagaatgccgtctcgcggatgatttcggacgcctcggcgggc
tga

DBGET integrated database retrieval system