KEGG   Rhizobium leguminosarum bv. trifolii CB782: RLEG12_03965Help
Entry
RLEG12_03965      CDS       T03015                                 

Definition
alpha-amylase
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rlu  Rhizobium leguminosarum bv. trifolii CB782
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RLEG12_03965
Enzymes [BR:rlu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     RLEG12_03965
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     RLEG12_03965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
unnamed:54546..57827
Genome map
AA seq 1093 aa AA seqDB search
MDTMNPDGAEQPLWYKDAIIYQLHIKSFYDANGDGVGDFAGLHAKLDHIAALGVNAIWLL
PFFPSPRRDDGYDIADYGSVSPDYGTVEDFRAFVDAAHERNIRVIIELVINHTSDQHPWF
QRARQAPAGSPERDFYVWSDSDQKFPETRIIFIDTEKSNWTWDAVAGAYYWHRFYSHQPD
LNFDSPLVMEELLKVMRFWLETGIDGFRLDAIPYLVEREGTINENLPETHAILKRIRAAL
DATHPGVMLLAEANQWPEDTREYFGEGDECHMAFHFPLMPRMYMAIAKEDRFPITDILRQ
TPEIPENCQWAIFLRNHDELTLEMVTDAERDYLWETYASDKRARINLGIRRRLAPLMERD
RRRIELMNALLLSMPGTPVIYYGDEIGMGDNIYLGDRDGVRTPMQWSPDRNGGFSRVDPA
RLVLPPVADPLYGFEAVNVEAQSTDAHSLLNWTRKMLALRGRHPAFGRGSLRFLSPENRK
ILAYLREYDGETLMCVTNLSRLPQAVELDLSAFEGRVPIELTGMSPFPPIGQLTYLLTLP
PYGFFWFQLEADADPPAWRTAPPEQLPDLVTMVLRRGLLDLVDEPRLGRVLSAEILPAYL
ARRRWFGAKDQPLRAARLISATPIPYADGIVLGELEVELPDHNESYQLPLAVAWDDAQPS
ALTQQLALGRVRQGRRVGFLTDGFAVEPMARGILRGLADRSRITGRTGTLEFLGTERLDR
LNVTDQMPVHWLSAEQSNSSLIVGDVAMIKLIRHIFPGVHPEVEMTRFLTCAGYDHTAPL
LGEVAHTDSSGRRSTLVIVQGAIRNQGDAWNWMLNNLRRGADELVLNDPAVEPGDDVFRP
LISFVAMVGMRLGELHVVLSGENADEAFSPVVAGDDEVEAIRKAVAGEVAYAMSKLAERE
ENVHPAVDLLARPLLERRSELVELGASLAESVRGTLMTRTHGDFHLGQILVSEGDAVIID
FEGEPAKNLAERRAKTVPLRDVAGLLRSLSYLVATAQLDNDAVTEHENEVRRGAIARFGR
HAEAAFLDAYWQAVSASKALAMPTEQRRRVLDAFLLEKAAYEIAYEARIRPKWLPIPLAG
LTEIVSRLAGVKA
NT seq 3282 nt NT seq  +upstreamnt  +downstreamnt
atggacacgatgaaccccgatggcgctgagcagcccctctggtacaaggatgcaatcatc
tatcagctgcatatcaagtcgttctacgacgccaatggagatggcgtcggcgattttgcc
ggcctgcacgccaagctcgaccatatcgcagcacttggcgtcaatgctatctggctcctg
cctttctttccatcgccgcgccgcgacgacggttacgacatcgccgattacggcagtgtc
agccccgactacgggacggtggaggacttccgcgctttcgtcgacgccgcccatgagcgc
aatatccgcgtcatcatcgagctcgtcatcaaccacacctccgatcagcatccctggttc
cagcgcgcccgtcaggcgcctgcgggatcgccggaacgcgacttctacgtctggtctgat
agcgatcagaaattcccggaaacgcgcatcattttcatcgatacggaaaagtccaactgg
acatgggatgcggtggccggcgcctattactggcaccgcttttactcccaccagcctgac
ctcaactttgacagtcccctggtcatggaggaactgctgaaggtgatgcgattctggctg
gaaaccggcatcgacggtttccggctcgacgcaatcccctacctcgtcgagcgcgagggc
acgatcaacgaaaacctgccggagacccatgcgattctcaaacgaatccgcgcagccctc
gatgccacccatcccggcgtgatgttgttggccgaggcgaatcagtggcccgaggacacg
cgcgaatattttggcgagggtgacgagtgccacatggccttccacttcccgctgatgcca
cgcatgtatatggcgatcgccaaggaggaccggtttccgatcaccgatattctgcggcag
acgccggagatcccggagaattgccaatgggcgatcttccttcgcaatcacgacgaactg
acactcgaaatggtgaccgacgccgagcgcgactatctctgggaaacctatgcatccgac
aaacgcgcccgcatcaatctcggcatcaggcggcgcctggcgccgctgatggagcgggac
cgccggcgcatcgagttgatgaacgcgctgctgctttctatgccgggaacgcctgtcatc
tattacggcgacgagatcggcatgggcgacaatatctatctcggcgaccgggatggggtg
aggacgccgatgcaatggtcgccggaccgcaatggcggcttctcccgagtagacccggcg
cgcctcgtcctgccgccggtcgccgacccgctctacggtttcgaggccgtcaacgtcgag
gcgcagagcacggacgcgcattcgctgctcaactggacgcgaaagatgctggcgttgcgc
ggcaggcatccggccttcgggcgcggttcgctgcgtttcctctcgcccgagaaccgtaag
atcctcgcctatctcagggaatatgacggcgagaccctgatgtgcgtcacaaacctctcg
cggctgcctcaagcggtcgaactcgacctctcggccttcgaggggcgcgtgccgatcgaa
ctgaccggcatgtcgccctttccaccgatcggacaactgacctatctcctgacgttgccg
ccctacggcttcttctggtttcagcttgaggccgatgccgacccgccggcatggcgcacc
gcgccgcccgaacagttgcccgatctcgtgacgatggtccttcgccgcggcctgctcgac
ctcgtcgacgagccgaggctcggacgcgtgctcagcgccgaaattctgcccgcttatctc
gccaggcggcggtggttcggcgcaaaggaccagccgcttcgggcggcccggcttatctcg
gcgacgccgatcccctatgccgatgggatcgttctcggcgaactggaggtggagctcccg
gatcacaacgaatcctatcagttaccgctggcggttgcctgggatgatgcgcaaccctcc
gccttgacccagcagcttgcgctcgggcgggttcggcagggcaggcgggtcggtttcctg
acggacgggtttgcagtcgagccgatggcgcgcggcatccttcgcgggctggccgaccgc
tcgcgcatcaccggacgcaccggcacccttgagtttctcggcaccgagcggctcgaccgt
ctgaatgtgaccgaccagatgccggttcattggctctcggccgaacagtccaacagttcg
ctgatcgtcggtgacgtcgccatgatcaagctgatccggcacattttcccgggggtccat
ccggaggtcgagatgacacggtttctgacctgcgcgggttacgatcacaccgctccgctg
ctcggcgaggtcgcacacaccgattccagcgggcgccgctccaccttggtcattgtccag
ggcgcgatccgcaaccagggcgacgcctggaactggatgttgaacaatcttcgtcgcggc
gccgacgagctcgtgctgaacgaccctgcggtcgagcccggcgacgatgtctttcggccg
ttgatcagcttcgtcgccatggtcggcatgagactcggggaattgcatgtcgtcctctcc
ggagaaaacgcggacgaggctttcagccctgtcgttgccggtgacgatgaggtggaggcg
atcaggaaggcggttgcgggcgaagtcgcctatgccatgtcgaagctggcggaacgtgag
gagaacgtccatcccgcggtcgatctgctcgcccgcccgcttctggagcgccgttctgaa
ctcgtcgaacttggcgccagccttgcggagagcgtccgcggcacgctgatgacgcgcacg
catggtgacttccatctcggccagatcctggtcagcgagggcgatgccgtcatcatcgac
ttcgaaggcgagcccgccaaaaatctcgccgagcgccgggcgaagacggttccgctgcgt
gacgtcgccgggcttctgaggtcgctcagctatctcgtcgccaccgcccagctcgacaat
gacgcggtcaccgaacacgaaaacgaggtgcgccgtggcgccatcgcccgtttcgggcgc
catgccgaggcggcttttctcgatgcctattggcaggcggtctccgcatcgaaggcgctc
gccatgccgacggaacaacgacggagggtgctcgatgcctttcttctcgaaaaggccgcc
tatgaaatcgcctatgaagcccgcatcaggccgaagtggctgccgatcccgcttgccggc
cttaccgaaatcgtatcgcgcttggcgggggtcaaggcatga

DBGET integrated database retrieval system