KEGG   Rhizobium leguminosarum bv. trifolii CB782: RLEG12_07420Help
Entry
RLEG12_07420      CDS       T03015                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rlu  Rhizobium leguminosarum bv. trifolii CB782
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rlu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RLEG12_07420
Enzymes [BR:rlu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     RLEG12_07420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
unnamed:777859..778788
Genome map
AA seq 309 aa AA seqDB search
MSEKSGIVILGIFAADTAYKAKRLPHIAETLMGSGFSLGPGGKGSNQAIAAAKAGGKVTF
ISRVGNDPFGEMALAAYSQAGVKANVMKMDGVSSGAAFIFVDEVSGDNAIIVVPGAAGLI
GIEDVDANRAEIESAAIFMTQLEQPLEAALHGLAMAKRAGVKTIFNPAPARAIPDEIYRL
CDFIVPNEVEAAELVGHPITTDEQVRVAGRTLLDRGAQAVIITLGARGAFYQSAGQSEFV
PAFSAGNVIDTTGAGDAFLGGFATAISEGQTPIEAIRFGSATAAIAVTRPGTAPAMPSRA
EISACLRRS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaaaagcggtatcgtcattctcggcatttttgccgccgacaccgcctataag
gcaaaacgcctgccccatatcgccgaaacgttgatgggatcgggcttctcgctcgggccc
ggcggcaagggctccaaccaggcgattgccgcagccaaggccggcggcaaggtgactttc
atttcgagggtcggcaacgatcccttcggcgagatggcgcttgcggcctattcgcaagcg
ggcgtcaaagccaatgtgatgaagatggacggtgtttccagcggcgccgccttcatcttc
gtcgacgaggtgagcggcgacaatgcgatcatcgtcgtcccgggtgccgcgggccttatc
ggtatcgaagacgtcgatgcgaaccgggcggagatcgaaagcgctgccattttcatgacc
cagctcgaacagccgctcgaggcggccttgcacggcctggcgatggcaaaaagggcaggg
gtcaagacaatcttcaaccccgcgccggcgcgcgccattcccgacgagatctatcgtttg
tgcgatttcatcgtccccaatgaggtggaagccgccgaattggtggggcatccgatcaca
acggatgaacaggtccgtgtggcgggccgcactctgctggatcgaggggcgcaagcggtg
atcatcacgctcggcgctcgcggcgcattttatcagagcgccgggcagagcgaattcgtc
cccgcattttcagccgggaatgtcattgacacaaccggggcaggggacgcctttcttggc
ggcttcgccacggcgatttcggaaggacaaacaccgatcgaggccatccgtttcggctct
gcgaccgctgcgatcgcggtaacacggccgggcacggcccctgccatgccttcgcgcgcc
gaaatcagcgcctgtttgcgccgctcgtga

DBGET integrated database retrieval system