KEGG   Rhizobium leguminosarum bv. trifolii CB782: RLEG12_08605Help
Entry
RLEG12_08605      CDS       T03015                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
rlu  Rhizobium leguminosarum bv. trifolii CB782
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RLEG12_08605
   00650 Butanoate metabolism
    RLEG12_08605
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RLEG12_08605
   00280 Valine, leucine and isoleucine degradation
    RLEG12_08605
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RLEG12_08605
Enzymes [BR:rlu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     RLEG12_08605
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     RLEG12_08605
Amino acid related enzymes [BR:rlu01007]
 Aminotransferase (transaminase)
  Class III
   RLEG12_08605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
unnamed:complement(1008810..1010090)
Genome map
AA seq 426 aa AA seqDB search
MAETELKTASFLSRRKESIPRGIVTAHPVVAARAKGSELWDVDGRRYLDFVGGIGVLNIG
HNHPRVVDAVKAQLDKVTHACFQVVGYEPYIALSEKLNGLVGEGYKSVFFTTGAEAVENA
VKIARGYTNRAAVIAFRGGFHGRTLLGITLTGMSQPYKQNFGPFAPEVYHIPYPNAYQGV
TTEDALGALEEIFATAAMPDRVAAIIIEPVQGDGGFLAAPVEFIQSLREVTRKHGIVLIA
DEIQTGFGRTGKMFGFQHSGIEPDLVTVAKSLAAGFPLSGVIGKSEIIDAPLPGGLGGTY
GGNAISCAAALAVLEAFEEENLLENGRQRAAELKAGLESLQQKFDFVGEVRGLGFMLAME
IVKDRKSKAPDADHTQRILDEACKAGLLVIKCGVHRNVVRFLAPLVTTSVQIQEALAIVD
KALAAA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaccgaattgaaaactgcctccttcctctcacgccggaaggaaagcatcccg
cgcggcatcgtcaccgctcatccggtggtcgctgcgagggccaaaggaagcgaactctgg
gacgtcgatggccgccgttatcttgactttgttggcggcataggtgtgctgaacatcggc
cacaaccatccgcgcgttgtcgatgcagtcaaggcgcaactcgacaaggttacacatgcc
tgcttccaggtggtgggctacgagccatatatcgccctgtcggaaaaactgaacggcctc
gttggtgaagggtacaagagcgtgttcttcacgactggtgccgaagccgtagaaaatgcg
gtgaagattgcccgtgggtacaccaaccgagcagcggtcattgcgtttcgcggtggcttc
catggccgcacgctgctgggaattaccctgaccggcatgagccagccctacaagcagaat
tttggccccttcgcgcccgaagtctaccatatcccgtatccaaacgcctatcagggagtt
acgaccgaggatgcacttggcgcgctcgaggagatttttgccacagcggcaatgccagat
cgtgtcgccgctatcatcatcgaaccggtccagggggatggaggtttcctggccgccccg
gttgaatttattcagtcgctacgcgaggtcacccggaaacacggcattgtactgatcgcc
gacgaaatccagaccgggttcggtcgcacgggcaaaatgttcggctttcagcattccggt
atcgaacccgacctggtcacagtcgccaaaagcctggcagccggtttcccattgtcgggc
gtcatcggcaagtcagagatcatcgacgcgccgcttccgggcgggctcggcggcacctat
ggcggcaatgcgatctcgtgcgctgcggcactagcggtgcttgaggcatttgaggaggag
aacttgctggaaaacggtcggcagcgcgcggcagagctcaaggcgggcctcgaatccctg
cagcaaaaattcgactttgtcggcgaagtgcgcgggctcggcttcatgctggcgatggaa
atcgtcaaggaccgcaagagcaaggcgccggatgcggaccatacccagcgcattctcgac
gaagcttgcaaagcggggctcctggtcatcaaatgcggcgtacatcgcaacgttgtgcgt
ttccttgcaccgctggtgaccacaagcgtgcagattcaggaagctttggcgatcgtcgac
aaggcacttgcagcagcctga

DBGET integrated database retrieval system