KEGG   Rhizobium leguminosarum bv. trifolii CB782: RLEG12_11585Help
Entry
RLEG12_11585      CDS       T03015                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rlu  Rhizobium leguminosarum bv. trifolii CB782
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rlu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RLEG12_11585
Enzymes [BR:rlu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     RLEG12_11585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(54733..55632)
Genome map
AA seq 299 aa AA seqDB search
MITVFGSINMDLIATTDRLPKPGETVAGNGFATAAGGKGANQALAARRAGRYVHMAGAVG
RDSFAADALALLDEAGTDLSLVEHVDGPTGTALILVGGDGENMIAVVPGANGLVTSADAE
TAIGGMSEGDILMLQLEVPVDAVERALSAARAKGITSILNLAPLIPDAPRLGRLADIVIA
NETEFERLAGQEGMDAQAREAALVRLHQETGQTLIVTLGGDGVVAIRDGAISRAQGLKIE
PVDTVGAGDTFCGYFAASLDEGLDFASALRRAAVAGSLACLKSGAQPSIPTSADVAARI
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgatcacagttttcgggtccatcaatatggacctcatcgccaccaccgaccgtctgccg
aagcccggcgaaacggtggctggcaacggttttgccacggccgccggcggcaagggcgcc
aaccaggcgctggccgcgcgccgcgccggccgctatgtgcatatggcgggcgccgtgggc
agggacagcttcgccgctgatgcccttgccctgctcgatgaggcgggaaccgatctttct
ctcgttgaacatgtcgatggccccaccggcaccgcgctgatccttgtcggcggcgacggc
gaaaacatgatcgcggtcgttcccggcgccaatggcctcgtcacatcggccgatgccgaa
accgcgatcggcggcatgagtgaaggcgatatcctgatgctgcagctcgaagtgccggtt
gatgccgtcgaacgcgctttatcggccgcccgcgccaagggcatcaccagcattctcaac
cttgctccgctaatccccgacgcgccgcgtctcggccggctcgccgatatcgtcattgcc
aacgagaccgagttcgagcggctcgccggacaggagggaatggacgctcaggcgcgcgag
gcggcactcgtccgcctgcatcaggagactggccagacgctgatcgtgaccctcggcggc
gacggcgtcgtcgccatccgcgacggggcgatttcaagggcgcaaggtctgaagatcgaa
cccgtcgatacggtcggcgccggcgacactttctgcggctacttcgcggccagcctcgac
gagggcctcgattttgcctcggcgctgcgccgagcggcggttgccggttcgctcgcctgc
ctcaaatcaggggcgcagccttcgatccccacgagcgcggacgtcgcagccagaatataa

DBGET integrated database retrieval system