KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_0025Help
Entry
Rmag_0025         CDS       T00438                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rma00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rmag_0025
Enzymes [BR:rma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Rmag_0025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(28956..30107)
Genome map
AA seq 383 aa AA seqDB search
MKNITLLGATGSIGKSTLSVVDLHSDKFNIFTLSANTNWQLMLELCNKYQPNYAIMVDES
SAEKLSTIITTDTQILSGTQALDKVVAHQDTDFVMAAIVGTAGMSSALCAVKAGKRIMLA
NKESLILAGDIFMKAVEEFNAELIPVDSEHSAIFQCLQSGRSGLNKIQLTASGGPFLHTP
ISKFKYITPNQACAHPNWSMGRKISVDSATMMNKGLEVIEAYYLFSLTPEQIDVVVHPQS
IVHSSVYYKDGSTLSQLGKPDMRTVISYAMSYPQRINSGVTALDLTNTPALEFYQPDFEK
FTCLKLAFETLNKGGNAMITMNAANEIAVEYFLNHQINFLDIPKIIDQTLSAMKHTTPNS
LEEVVNNDLVAREMTREIIKQYG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatataaccctgcttggtgcgactggatctatcggtaaaagcactttgtcggtg
gtagatttacactctgataaatttaacatttttactctaagtgccaataccaactggcaa
ttaatgcttgaactgtgtaacaaatatcaacctaattatgcaatcatggtagacgagtcg
tctgctgaaaaattatcaaccatcattacgactgatacacaaatacttagtggtactcaa
gcgctagataaagttgttgctcatcaagataccgactttgttatggctgctattgtgggc
actgctggcatgtcctcagcactttgcgccgttaaagcaggtaagcgcattatgcttgca
aataaagaatcgttaatattggcaggtgatatttttatgaaagcagtagaagaatttaat
gccgaactgattcctgttgattcagagcatagcgcaattttccaatgtctacaaagtggt
agatcaggcttaaacaaaatccagttaactgccagtggtggcccatttttgcatacaccg
attagcaaatttaaatacatcaccccaaatcaggcctgtgcacatccaaactggtcaatg
gggcgtaagatttcggttgattctgccactatgatgaacaaagggctggaagtgattgag
gcctattacttattttcacttacaccagaacaaattgatgtggtggtacacccgcaaagc
attgtgcactcatcagtctattataaagacggctcaacattatctcaattaggtaaacca
gatatgcgtacagttatctcatatgccatgagttatccacaacgtattaactctggtgtt
actgcgcttgacttgactaatactcctgccttagagttttatcagccagattttgaaaaa
tttacttgcctaaaactagcctttgaaacgctaaataagggtggcaacgctatgattacc
atgaatgcagccaatgaaattgcagttgaatattttcttaatcatcaaatcaactttcta
gatataccaaaaattattgaccaaacactaagtgccatgaaacacacaacaccaaactct
ttagaggaggttgtcaataacgaccttgttgctcgtgaaatgacccgtgaaataatcaag
caatatgggtaa

DBGET integrated database retrieval system