KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_0045Help
Entry
Rmag_0045         CDS       T00438                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
rma00240  Pyrimidine metabolism
rma00250  Alanine, aspartate and glutamate metabolism
rma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rma00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rmag_0045
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rmag_0045
Enzymes [BR:rma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Rmag_0045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ABL01848
UniProt: A1AV91
Position
complement(54174..55136)
Genome map
AA seq 320 aa AA seqDB search
MKKDLISNHIQLDDSGKLIHLLGLEGLSKQYLIHILDTADSLIDVSGNLKKSKALDDIFV
ANLFFEPSTRTRNTFEIAAMRSSANVINVDLANSALKKNEDLLNTMRTLKAMQIDMFVIR
HKQNGLPHHVVQHLKDVSILNAGDGINAHPTQALLDMLSIRQHKKTFENLSVAIVGDITH
SRVAHSDIQALKTLGTTDIRLIAPKVLQYNLAPCSVVKHFDDIEPGLKNCDVVIVLRLQK
ERMIEADIPNEQEYFDNFGLTPKRLALAKPDAIVMHPGPTNRGVEIDSNVADGNQSIILQ
QVTNGIAVRMAVMQILVNKS
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagatttgattagtaaccacattcaactagatgactccggtaaattaattcat
ctactaggtcttgagggtctttctaaacaatatttaattcacattcttgatacggccgat
agcctgattgacgtctctggtaatttaaaaaaatccaaagcactagatgatatttttgtt
gctaatttattttttgaaccatcaacgcgtacgcgtaacacattcgagattgccgcaatg
cgcagcagtgccaatgtcattaacgttgaccttgcaaactcagcactcaaaaaaaatgaa
gatttgcttaacactatgcgcacacttaaggctatgcaaattgatatgtttgtgattcgc
cataaacaaaatggcctaccacaccacgtggtacaacatttaaaagatgtctctattcta
aacgcaggtgatggcattaatgcacacccaacccaagcactacttgatatgcttagcatt
cgccaacacaaaaaaacatttgagaatttatcagtcgctattgtgggcgatatcactcat
tcacgtgttgctcactctgatattcaagcacttaaaacactaggtacgactgatattcgc
ctcattgccccaaaagtcttacaatataatttggcaccttgttcagtagttaaacatttt
gatgatattgagccagggcttaaaaattgcgatgtggtgattgtattaagattacaaaaa
gaacgtatgattgaagccgatattcccaatgaacaagaatattttgataattttggactc
acgccaaaacgcctagcattagcaaaaccagatgctattgtaatgcacccaggcccaact
aatcgtggtgttgagattgattcaaatgtggctgatggcaatcaatcaatcatcttacaa
caagtcactaatggcattgcagtacgtatggcagtcatgcaaattcttgttaacaaatca
tga

DBGET integrated database retrieval system