KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_0110Help
Entry
Rmag_0110         CDS       T00438                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rma00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rmag_0110 (ipk)
Enzymes [BR:rma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Rmag_0110 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(130808..131665)
Genome map
AA seq 285 aa AA seqDB search
MSSTWLAPAKINLFLHINNKREDGYHNLQTIFQMLDYYDELKFSITNGGVIKRINGNEDV
EQSQDLIVKAAKVLQEYTGTTLGANLSIVKNIPIGGGLGGGSSDAATTLVALNQLWDTKL
TQPQLMKLGLNLGADVPVFIFAKSAWAEGIGEILSPIKMPNYYYLVVFINKHTSTKEIFS
HYALTMSKPQGKIAKFSELINTHNDCLQAAIALEAEIGVALKHLNTCANHISQVRMSGTG
SCVFNEFLTEKDALAAAKKVPKKWMSFVTRAINTSPIHSWAVAKR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtacttggctcgcccctgcaaaaattaatttatttttgcatattaacaacaaa
agagaggatggttatcataatttgcaaaccatttttcaaatgcttgattattacgatgaa
ttaaaattttctatcactaatggtggcgttattaaacgtattaatggtaatgaagatgta
gagcaaagccaagatttaatcgttaaggcagccaaagtacttcaagaatacactggcaca
acgttgggtgctaacctctcaatcgttaaaaatattccaattggtggtggcttaggaggt
ggctcttcagatgcagcaaccacgttagtggcacttaatcaactttgggatacaaaatta
acccaaccacaactcatgaaattgggattgaatctaggtgcagatgtacctgtatttatc
tttgctaaaagcgcttgggcggaaggtataggagaaattctaagccctattaaaatgcct
aattattattatttggttgtctttattaacaaacatacttcaactaaagaaattttttct
cattatgcattgacaatgagcaaacctcaagggaaaatagccaagttctctgaacttata
aatactcataatgactgcttacaagcagctatagcattggaggcagaaattggtgttgca
ctaaaacaccttaatacttgtgctaatcatattagccaagttagaatgagcggcacaggt
agctgtgtttttaatgaattcttaactgagaaagacgctttggcagcggctaaaaaagtg
ccaaaaaaatggatgagttttgtaacacgtgcaatcaacacttctccgattcatagttgg
gctgtcgccaagcggtaa

DBGET integrated database retrieval system