KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_0155Help
Entry
Rmag_0155         CDS       T00438                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:rma00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Rmag_0155
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Rmag_0155
Enzymes [BR:rma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Rmag_0155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(180638..182032)
Genome map
AA seq 464 aa AA seqDB search
MNISQLLANIVQTKIDIEIKGLCLNAQSTQPGDLFIALQGKLTHGADYINQAIDKGCVAI
LVDSKEIECVIPSIRIDNLSQYLQTLANTFYKNAIKVNIISITGTNGKTSVAYFISQLLT
KLGIKNGLIGTLGITHSQQLSLNTTPDILTLYQVLDNYYQNNIHHAILEVSSHALTQDRI
AGLNIKQAIFTNLTQDHLDYHHTLDKYQATKEKLFVLDTVESVILNQDDSHYKHFLNITK
DKKRISYSLGDFDSIKTIEQGFLVQLDHYVFEIPFLGEFNLLNILAALNSVEALGFKRDD
IIPLFYQLLPPPGRMQRIEPHLAWIDYAHTPDAIGNAITTLKKHYPNFKIRIVFGCGGNR
DKDKRAEMGKIASNLADTIILTNDNPRSENPKTIIENILSGIDDSYKLDIIENRQLAIET
AITTLKENECLLIAGKGHETIQQFSDKTIYLNDLEIAQNSTKAI
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaatatttctcagcttttagccaatattgtacaaactaagatagacatagagataaag
ggcttgtgtcttaatgctcaaagcacacaacctggagatttgtttattgcacttcaaggg
aaattaacacacggtgctgattatatcaaccaagcaatcgacaaaggctgcgttgctata
ttagttgactcaaaagagatagaatgtgtcattccatctattcgtattgacaacttatct
caatatttacaaacactggcaaatactttttataaaaatgctataaaagttaatatcatt
agtatcacaggtacgaatggtaaaacttctgttgcctactttatctcgcaattactaacc
aaacttgggattaaaaatggtttaattggcactttaggtatcactcatagtcaacagtta
tcccttaatacaacgccagatattttgacgctttaccaagtattagataattactatcaa
aacaatattcatcacgccatacttgaggtttcttcacacgcactcactcaagatagaatt
gctggattgaatattaaacaagcaatatttaccaatcttactcaagatcatcttgattat
catcacacacttgataaatatcaagcaaccaaagaaaaattatttgttcttgatactgtt
gaatctgttattcttaaccaagatgatagtcattacaaacattttctaaatatcactaaa
gataaaaaacgaatcagctactctctaggtgattttgactcaatcaaaaccattgaacaa
ggctttttagtgcaattagaccattatgtttttgaaatcccatttttaggtgagtttaat
ttactgaacattttggcagcattgaacagtgttgaggcgcttggatttaaacgtgatgat
attattccgctattttatcaactattgccaccacctggtagaatgcaaagaattgagcct
catcttgcttggatagattatgcccatacacctgatgccatcgggaatgccatcaccact
ttgaaaaaacactatccaaacttcaaaattcgtattgtctttggttgtggcggtaaccga
gacaaagataaacgcgcagaaatgggcaaaattgcctcaaatctagcggatactattatt
ttaaccaatgacaaccctaggtctgaaaatccaaaaaccattattgaaaacatcttaagt
ggcattgacgatagttacaaattagacattattgaaaatagacagcttgctatcgaaacg
gcaatcacaacactcaaagaaaatgaatgcttactaattgctggcaaaggacatgaaacc
atacaacaattctctgataaaacaatctacctaaatgacttagaaattgcacaaaatagc
actaaagctatttaa

DBGET integrated database retrieval system