KEGG   Candidatus Ruthia magnifica: Rmag_0210Help
Entry
Rmag_0210         CDS       T00438                                 

Definition
thiol-disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
rma  Candidatus Ruthia magnifica
Brite
Enzymes [BR:rma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Rmag_0210
Secretion system [BR:rma02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Rmag_0210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(226039..226764)
Genome map
AA seq 241 aa AA seqDB search
MLKLLFITTVLFSNNAFADKNAIINTLYPFFGTIDKQYIINTPLSDIFEITLRNLIDSLL
VSKNDRYLIQNNVVDLTTTARQLIPMNGNVKLIKQALINTIDDHDKIIYPAKNEKYIIHV
FTDVDCPFCKKLHNGMKQMNDLGITVKYLASPLASLHPAAQGKMERIWCADDPVKAMDDY
KKNKIILNLKTCHNPVANQLAISKQLGVNGVPTIFLEDGTHLLGYMTPAILLQKIKATIG
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaattactattcatcacaaccgtcttattttctaataatgcttttgcagacaaa
aacgcaattattaacactctgtatccattttttggcacgattgacaaacaatatattatc
aacacaccattaagcgatatttttgagataactctccgtaatctcattgattctctttta
gtatctaaaaatgatcgttatttaatccaaaataatgttgttgatttaaccactaccgct
agacaacttataccaatgaatggtaatgttaaattgattaaacaggccttaattaacaca
attgatgatcacgacaaaatcatttacccagcaaaaaatgaaaaatatattatccatgta
tttactgatgttgactgtccattttgtaaaaaacttcataatggtatgaagcagatgaat
gatttaggtattactgttaaatatctcgcttcgccacttgcatccttacacccagcagcg
caaggaaaaatggaaagaatttggtgcgctgatgacccagtcaaagcgatggatgattat
aagaaaaataaaattatactcaacttaaaaacttgtcataatccagtagctaaccaatta
gcaatttctaagcaactaggtgtaaatggtgtacctaccatcttcttagaagatggtacg
catttacttggttatatgacacccgccattttgttacaaaaaattaaagcaacaattggc
aaataa

DBGET integrated database retrieval system