KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_0274Help
Entry
Rmag_0274         CDS       T00438                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rmag_0274
  Amino acid metabolism
   00300 Lysine biosynthesis
    Rmag_0274
Enzymes [BR:rma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Rmag_0274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
299609..300739
Genome map
AA seq 376 aa AA seqDB search
MNKTLKLAKNLVSIDSITPQDKGCQSIMTNHLSHLNFKITDLKFGEVDNFWAIRGHQSPV
FVFAGHTDVVPVGDELKWHISPFSAQVQDGMLHGRGTADMKGSLAAMLSATDRFVKDYPN
HKGSIGYLITSDEEGPATDGTVKVAKYLKEINQIVDYCLVGEPSATNELGDVIKNGRRGS
LNGILKIIGKQGHIAYPHLADNPIHLAISALNDLCNEVWDKGNEYFPATSFQISNIHSGT
GVTNIIPGESDVVLNFRYSTQNTHKQLQSRVCVILNKHNFEYQITWEHSGYPFLTPKGKL
VNACTNAIKTVKNINTQLSTSGGTSDGRFIALILKAQVVELGPLNATIHQVDECVSIQDL
EDLSDIYYHVLKNILT
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaccttaaaattagcaaaaaatcttgttagtatagattctattaccccacaa
gataagggttgtcagtctattatgaccaatcatttgagccatcttaattttaaaattacc
gatttaaaatttggtgaggttgataatttttgggcaattcgcggtcatcaatctcctgtg
tttgtgtttgcagggcataccgatgtcgtgcctgtgggtgatgagctaaaatggcacata
tcacctttttctgcccaagttcaagatggtatgttgcatggtcgtggaacagctgacatg
aaaggttctttggcagctatgcttagtgcaaccgatagatttgttaaagattatcctaat
cataaaggctcaatcggctatttaatcacttctgatgaagaaggtcctgctactgatggc
actgttaaagttgcgaagtacttaaaagaaatcaatcaaatcgttgattattgtttagtg
ggtgagccatcagccactaatgaattaggagatgtaattaaaaatggtcgtcgtggctct
ttaaatggcattttaaaaatcattggtaaacaagggcatattgcttatccacatttggca
gataatcctatccatctagccatatcagcgttaaatgatttgtgtaatgaggtttgggat
aagggcaatgagtattttccagcaaccagttttcaaatttctaatatccattcaggcaca
ggggtgactaacattattccaggtgaaagtgatgttgttcttaactttcgttattctaca
cagaatactcacaagcaattgcaaagccgagtttgcgtgattttaaacaagcataatttt
gaatatcaaattacttgggaacattctggctatccatttttaaccccaaagggtaaattg
gttaatgcttgtactaatgcgattaaaaccgtcaaaaatataaacacccaactctccact
tcaggcggtacctctgatggacgttttattgcactaattttaaaggctcaagtggtagaa
ctaggtcctttaaatgccaccattcaccaagttgacgagtgtgtatccatccaggattta
gaagatttgagcgatatttattatcatgttttaaaaaatatactcacttaa

DBGET integrated database retrieval system