KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_0318Help
Entry
Rmag_0318         CDS       T00438                                 

Definition
Beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rma00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Rmag_0318
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Rmag_0318
Enzymes [BR:rma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Rmag_0318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
346518..347501
Genome map
AA seq 327 aa AA seqDB search
MMGPIMMDVSGLALTTQEKQQLIKPSIGGVILFGRNFESIEQVTLLIKDIRQVNQNLLIA
VDHEGGRVQRFRYGFTHLPAMSKLGALYDKNPDIVIDKAFSCGFVLAYELLDIGVDFSFA
PVLDINYDTSQVIGDRAFHSNPDVIVKLAGSLISGMHKAGMKCVGKHFPGHGFVTADSHI
DLPIDDRPMSDLLQDMKPFKRLINHGLDALMYAHVVYTQVDDKIAGFSSKWIKDILQNQL
KFKGVIFSDDLSMQSAHFIKDITNRVKTSLDSGCDMVLICNHPEFVAQIIDKDWGVSKKL
QSMQGFYKFKSDKINHQQHLASIRDLL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgatgggtcctattatgatggatgtgtcaggattggcattgaccacacaagagaaacaa
caattgattaagccatctattggtggtgttattttgtttgggcgtaattttgaatctatt
gaacaagtaactttattaattaaagacattcgtcaagttaaccaaaacttactgattgct
gttgatcatgaaggtgggagagtacagcgttttcgatacggatttactcatctaccagcc
atgtcaaaattaggtgcattgtatgataaaaatccagatatagtgatagataaagcattt
tcttgtggttttgtcttagcatatgagttgttggacattggtgtagatttttcttttgca
cctgtgttggatattaactatgatacttcccaagtgattggcgacagagcttttcattct
aatcctgatgtgattgtaaaattagcaggcagtttaattagtggcatgcacaaagcgggt
atgaaatgtgttggcaagcattttccagggcatggatttgttacggcagattcacacatt
gacttgccaatagatgatagaccaatgagtgatttgttacaagatatgaaaccctttaag
agattaattaaccatggacttgatgcgctcatgtatgctcatgttgtttatactcaagta
gatgacaaaatagcaggattctcctctaagtggattaaagatattttgcaaaatcaactc
aaatttaaaggtgttatttttagtgatgatttatctatgcagagtgcacatttcattaaa
gatataaccaatagagtgaaaacatcattagatagcggttgtgacatggtacttatatgc
aaccatccagaatttgttgcacaaatcattgataaagattggggcgtgagtaaaaaatta
caatcaatgcaaggtttttataagtttaaatcagataaaattaaccatcaacaacattta
gcaagcattagagatttattatga

DBGET integrated database retrieval system