KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_0373Help
Entry
Rmag_0373         CDS       T00438                                 

Definition
asparagine synthase (glutamine-hydrolyzing)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rma00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rmag_0373
Enzymes [BR:rma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Rmag_0373
Peptidases [BR:rma01002]
 Cysteine Peptidases
  Family C44
   Rmag_0373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
410980..412755
Genome map
AA seq 591 aa AA seqDB search
MCGLCGQLRFDSQVVSGDELKVMMQKIARRGPDSSGLWVDDNIGFGHQRLAIIDLSNHAH
QPMIDKNLGLILIFNGTIYNYQALRQDLTKQGYQFFSHSDTEVIIKAYHYWGESCVTHLD
GMFAFCIWDKIQNQLFIARDRMGIKPLYFNLTNQAFSFASNMQALITQGIDKSINPIALQ
QQLSLHGVVPAPNTIINGVNKIKPATTLTISAKGKVVERTYWKPKAIRPKETLTDEQFIQ
RTHELLTDSVLKRMNAADVPIGVLLSGGLDSSLLVALLREAGHENVRTFSIGFENIDDEV
GSEFEYSDQIVAQFKTRHEKYVISNSQVLPRLGEAVSNMSEPMVAQDAVAFYLLSEQVSK
HIKVVLSGQGADEAFAGYFWYERMQAQTGSEIERFTKHYVDRSYEEYLQTVNQQYHSNNH
TETWLHYEFAKASADTFMDKVFRTDITRLVVDDPVKRVDNMTMAWGLEARVPFMDYKLIE
HALSVSPSLKMLNKGKHLLKQIARGLLLPDSVIDRKKGYFPMPALKYVRGEFLDFMSGIL
TSSKCINRGVFNQTFIAKIINKPQNYMTALNGSRLWHLALLEYWLQINIDE
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggactttgtgggcagttaagatttgacagccaagtggtgagtggcgatgaactt
aaggtaatgatgcaaaaaattgctcgtcgtggccctgattctagtggtctttgggttgat
gataatattggttttgggcatcaaaggcttgctattattgatttatctaatcatgctcat
cagccaatgattgataaaaatcttggtttgattttgatttttaacggtacgatttataat
tatcaagctttacgtcaagatttaaccaagcaaggttatcaatttttctcgcattctgat
actgaagtgattatcaaagcttatcattattggggtgagagttgtgtcacgcatttagat
gggatgtttgctttttgtatttgggataagattcaaaatcaattatttattgctcgtgac
cgaatggggattaaaccgctttattttaatttaacaaatcaagcatttagctttgcttct
aacatgcaggcgttgataacacaaggtatagataaaagcattaatcctatcgctctacag
cagcaactttcattgcatggtgttgtgccagcacctaatacgattattaatggtgtgaat
aaaattaaaccagcaaccacgttaaccattagcgctaagggtaaagttgttgaaagaact
tattggaagccaaaggccatacgcccaaaggagacattaacggatgagcagtttattcag
cgcacgcatgaacttttaacagacagtgttttaaaacgcatgaatgctgcagatgtacca
attggcgtgttgctttctggcggtctagattcatcactcttagtagcattacttagagag
gcaggacatgaaaatgtgcgtacattttcaattggttttgaaaatattgatgatgaggtc
gggtctgaatttgaatattctgaccaaattgttgcccagtttaaaacccgacatgaaaaa
tatgtcattagtaattcacaagtgttaccacgccttggtgaagcagtttcaaatatgagc
gagccaatggtagctcaagatgcagtggcattttatttattatctgaacaagtatctaag
catattaaagtggtgctttctggccaaggtgcagacgaggcttttgcaggttatttttgg
tatgagcgcatgcaagcacagacaggctctgagattgaacgttttaccaagcattatgtg
gacagatcatacgaagagtatttgcaaacggttaatcagcaatatcacagtaacaatcat
accgaaacttggcttcattacgaatttgctaaggcaagtgcagatacatttatggataaa
gtatttcgcactgatattactcgtttagtggtagatgatcctgtgaaaagagtagataac
atgaccatggcttggggtttagaggcgcgcgttccatttatggattataagttaatagaa
catgctttgagcgtatcaccgagtttaaaaatgcttaataaaggcaaacatctccttaaa
caaattgctagaggtttgttgttgcctgatagtgtaattgaccgtaaaaaaggttatttc
ccaatgccagcactcaaatatgtgcgtggtgaatttttagactttatgtcaggcatatta
acttcaagcaaatgtattaatcgtggtgtgtttaatcagacatttattgctaaaataatt
aataaaccgcaaaattatatgactgcacttaatggttcacgtttatggcatttagcatta
ttggaatattggctgcaaataaatattgatgaataa

DBGET integrated database retrieval system