KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_0409Help
Entry
Rmag_0409         CDS       T00438                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
rma00860  Porphyrin and chlorophyll metabolism
rma01100  Metabolic pathways
rma01110  Biosynthesis of secondary metabolites
rma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rmag_0409
Enzymes [BR:rma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Rmag_0409
Exosome [BR:rma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rmag_0409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD MOFRL
Motif
Other DBs
NCBI-ProteinID: ABL02171
UniProt: A1AW64
Position
complement(446938..447924)
Genome map
AA seq 328 aa AA seqDB search
MTILTHRPRRMRKHAHTRKLIRENNLTTSDLIFPIFIIEGENKRQSIDSMPDIKRLSIDQ
LLIEAAELIELGIQAIALFPIVPSKKKSLHAQEAFNPNGLAQRAIRAIKQKYSNLAVISD
VALDSFTTHGQDGLINDEGYVLNDETIKVLVKQALSHAQSGSDIVAPSDMMDGRISVIRK
ALEENGFIHTSILAYSAKYASHYYGPFRDAVGSSVNLGTSNKETYQMDPANSNEAIREVG
LDIDEGADIVMIKPGLPYLDIVYRVKQTFGIPTFTYHVSGEYVMLKAAVQNNWLKEEQVV
LETLLAFKRAGADGILTYYAKQAAGWLK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacaattttaacccatagaccacgtcgtatgagaaaacacgcacatacccgtaaatta
atacgtgaaaataacctaacaactagtgatttaatctttccaatttttatcattgaaggt
gaaaataaacgacaaagtattgattcaatgccagatattaagcgtttaagtattgatcaa
ttattaattgaagcggccgaattgattgaattgggtattcaagccattgcactttttcct
attgttccatcaaaaaaaaaatcattacatgcacaagaagcatttaatccaaatggtttg
gcacaacgtgctatacgcgctatcaaacaaaaatattcaaatttagcagtgattagcgat
gtagcacttgactcatttaccacgcatggtcaggatggcttgattaatgatgagggttat
gtgctcaacgatgaaacgattaaagtcttggtaaaacaagccctctctcatgcacagtca
ggtagcgatatcgtggcaccaagtgacatgatggatggacgtataagtgtcattcgtaaa
gcacttgaagaaaatggatttattcatacgagtattttggcttattctgcaaaatatgcc
tcccattattacggcccctttagggatgctgttggctcttcagttaatttaggtacgtct
aacaaagaaacttaccaaatggatcctgctaattctaatgaagctattcgtgaagtgggt
ttagatattgatgaaggtgcggatatagtcatgattaaacctggattgccctacttagat
attgtttatcgggtcaagcaaacctttggtatacctacctttacttatcatgtaagtggt
gaatatgttatgttaaaagcggctgtacaaaataattggctcaaggaagaacaagtggta
ttagaaactttgttggcgttcaagcgtgctggtgccgatggtattttaacttattatgct
aaacaagctgctggttggctaaagtaa

DBGET integrated database retrieval system