KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_0413Help
Entry
Rmag_0413         CDS       T00438                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:rma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rmag_0413
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Rmag_0413
Enzymes [BR:rma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Rmag_0413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
452387..453157
Genome map
AA seq 256 aa AA seqDB search
MSKQRWVIKIGSALLTNDGKGLDKTAIISWVRQIKELIQQNIDIILVLSGAIAEGMKRLG
WNERPENIHKLQAAAAVGQMGLVQTYETLFAQYNIHTAQVLLTHDNLANTNQSDNISATL
NTLLSLGTVPIVNENDTVATDEIKFGDNDTLAALVVNLVGATQLVILTDQGGIYDADPRQ
NANAKLINKIHVNDEKLTQVASRACGSLGSGGMYTKVLAAKIAAKSDVITIIASGRQVDV
LSKLGAGKHIGTLIHC
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcaaaggtgggttattaaaattggttctgcactcttaaccaatgatggtaaa
ggtctggataaaaccgctattatctcatgggtaaggcaaattaaagaattaatccaacaa
aatattgatattattttggttttaagtggtgcgattgccgagggtatgaagcgtctaggt
tggaatgaacgtcctgaaaatatacataaattacaagcagcagcagcggtaggacaaatg
ggcttagtgcaaacttatgaaactttatttgctcagtataatattcataccgcacaagtg
ctattaacacatgataatttagctaatactaatcaaagtgataatatttctgccacttta
aatacactattaagtcttggcacagtgccaattgtgaatgaaaatgacacagttgctaca
gatgaaattaaatttggtgataatgatactttagcggcattagtagtaaatttagtgggt
gcaactcaattggttattttgactgatcaaggtggtatttatgatgctgatccacgtcaa
aatgctaatgctaaattgattaacaaaatccatgtgaatgacgaaaaattaacgcaagtt
gctagtagagcatgtggttcactaggttctggcggtatgtataccaaagtattagcagcc
aaaatagccgctaaatcagatgtaattactattattgcctcaggcagacaagtcgatgtt
ttgtctaaactgggggcaggtaaacatattgggacattgattcattgctag

DBGET integrated database retrieval system