KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_0456Help
Entry
Rmag_0456         CDS       T00438                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
rma00010  Glycolysis / Gluconeogenesis
rma00030  Pentose phosphate pathway
rma00051  Fructose and mannose metabolism
rma00052  Galactose metabolism
rma00230  Purine metabolism
rma00500  Starch and sucrose metabolism
rma00520  Amino sugar and nucleotide sugar metabolism
rma00521  Streptomycin biosynthesis
rma01100  Metabolic pathways
rma01110  Biosynthesis of secondary metabolites
rma01120  Microbial metabolism in diverse environments
rma01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rmag_0456
   00030 Pentose phosphate pathway
    Rmag_0456
   00051 Fructose and mannose metabolism
    Rmag_0456
   00052 Galactose metabolism
    Rmag_0456
   00500 Starch and sucrose metabolism
    Rmag_0456
   00520 Amino sugar and nucleotide sugar metabolism
    Rmag_0456
  Nucleotide metabolism
   00230 Purine metabolism
    Rmag_0456
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rmag_0456
Enzymes [BR:rma01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Rmag_0456
    5.4.2.8  phosphomannomutase
     Rmag_0456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV Mer2
Motif
Other DBs
NCBI-ProteinID: ABL02214
UniProt: A1AWA7
Position
complement(497533..498948)
Genome map
AA seq 471 aa AA seqDB search
MFKISLLLLRYSIKKMSISQSIFKAYDIRGIVKQDLSPKNVNLIGLAIGSESIAKGERNV
VVGRDGRLSGVDLMQALKVGLQESGCHIVDIGMVPTPLVYFATYTKISTSGVMITGSHNS
PEYNGFKIIIAGETLSSERIQALYQRIQISNFSSGHGTSIKMDIEQDYIERITRDVKLDR
SLSIIVDAGNGIAGNIAPKLFEQLGAKVTKLFCLVDGNFPNHHPDPSKLHNLEDIIKKVK
STGADMGFAFDGDGDRLGLIDNKGNVIWADRQMMLYSRDILKRNQGAKIVFDVKCSSLLP
KDIVQHGGKAIMSRTGHSFIKAKLKEINAALGGEMSGHIFFKERWYGFDDALYTGSRLLE
ILSKTEKTCTEVFAELPDNINTPEINIHFDEQGQQFDAMNKLAKNIDFPNAKITTIDGVR
IDYKNSWGLVRPSNTTPCLVLRFEADDEKILKKIQEKFKAWLKNNDILIDF
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaataagtcttttacttttacgttattctatcaaaaaaatgagtatttcgcag
tcaatatttaaagcttacgatattcgtggtattgttaagcaagatttatcccctaaaaat
gtcaacctcatcggtttagcaattggtagtgaatctattgccaaaggtgagcgtaatgtt
gttgttggtcgtgatggtcgtctaagtggcgtagatttaatgcaagctttaaaagttggt
cttcaagaaagtggttgtcatattgtggatattggcatggtaccaacgcctttggtatat
tttgcaacgtatactaaaatcagtacttcaggtgtgatgattacaggctcacacaattct
ccagaatataatggctttaaaatcataattgcaggcgagacactttctagtgaacgtatt
caagcgctttatcagcgtattcagattagtaatttttcctcaggtcacggcacttcaatt
aagatggacattgaacaagattatattgagcgtatcacacgtgatgttaaattagatagg
tcacttagtattattgttgatgcaggcaatggtattgcaggaaatattgcaccaaaacta
tttgagcagctaggcgctaaagtaacaaaattattttgcttagttgatggcaatttccct
aaccatcaccctgacccctctaagcttcataatcttgaagatattatcaaaaaagttaaa
agcacaggtgcagatatgggttttgcctttgatggcgatggcgaccgactaggtctaatt
gacaacaaaggtaacgtaatttgggctgatagacaaatgatgctatattcaagagacatt
ctcaaacgcaatcaaggcgctaaaattgtctttgatgttaaatgctcatcactactacca
aaagacattgttcaacatggtggcaaagcaattatgtcacgcacagggcatagtttcatt
aaagctaaattaaaagaaattaacgcagcacttggcggcgaaatgagtgggcatatattt
tttaaagagcgctggtatgggtttgatgatgctttatatacaggatcacgcctactagaa
atcttatcaaaaactgaaaaaacttgtaccgaagtatttgccgaattacccgataatatc
aatacaccagagattaacattcactttgacgaacaaggtcaacaatttgatgcaatgaat
aaattggctaaaaatattgatttcccaaacgcaaaaatcactaccattgatggtgtacgc
atagattataaaaatagctgggggctagtccgcccttctaacaccacgccatgtttggtg
ttgcgctttgaagcagatgatgaaaaaatcttaaaaaaaattcaagaaaaattcaaagca
tggttaaagaataatgatattcttattgacttttaa

DBGET integrated database retrieval system