KEGG   Candidatus Ruthia magnifica: Rmag_0538Help
Entry
Rmag_0538         CDS       T00438                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
rma  Candidatus Ruthia magnifica
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:rma01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:rma00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
588492..589796
Genome map
AA seq 434 aa AA seqDB search
MNRQEQTNVLTKDWAENPRWKNVKRAYNAKDVVRLRGSIQPEYTYARLGSEKLWKLINDS
SKKGYVNCMGAITAGQAMQQAKAGIEAIYLSGWQVAADGNTSETMYPDQSLYAYDSVPTM
VRRINNTFKRADEIQWAKGINQNDQEYVDYFLPIIADAEAGFGGVLNAYELMKNMIVNGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLTSARLAADVMGIPTIVLARTDAEAATL
LTSDVDPRDERFVTGKRTPEGFYIVKNGLEQAISRGISYAPYADLVWCETGKPDLGFARE
FAQAVLVNNPEQLLAYNCSPSFNWKKNLNDSQIASFQEDIAAMGYKYQFITLAGIHNMWY
NMFELAHEYAQGEGMKHYVEKVQEPEFAAAEKGYTFASHQQEVGAGYFDDVTTVIQGDTS
SVTALTGSTEAAQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaatagacaagaacaaacaaatgtattgacaaaagactgggctgagaatccacgttgg
aaaaatgtgaaacgcgcttataatgcgaaagacgttgtacgtctacgtggctccatacag
cctgaatatacttacgcacgattaggttctgaaaaattatggaaactgattaacgattct
tctaaaaagggttatgttaattgtatgggcgcaatcacagcaggtcaagcgatgcagcaa
gcaaaagcaggtattgaggcaatttatttatcaggttggcaagttgctgctgacggtaac
acatcagaaaccatgtatcctgatcaatccttgtatgcgtatgactcagtaccaacaatg
gtgcgtcgcattaacaatacctttaaacgtgctgatgaaattcagtgggcaaaaggtatc
aatcaaaacgatcaagagtatgttgattattttctacctattattgctgatgctgaggct
gggtttggtggtgtattaaatgcttatgagttgatgaaaaatatgattgtcaatggtgca
gcagccgttcattttgaagatcagttagcttcggttaaaaaatgtggacacatgggtggc
aaggttttagttcccactcaagaagcgattcaaaaactcacttcagcacgcttagcagca
gatgtaatgggtattcctacgattgtattagcacgaactgatgctgaggcagcaacccta
ttaacgtctgatgtagatcctagagatgaaagatttgtgactggtaaacgtactccagaa
ggattttatattgttaaaaatggtcttgagcaagccatttcacgcggtatttcatacgca
ccatatgctgatttagtatggtgtgaaactggaaaaccagatttaggttttgctcgtgaa
tttgctcaagcagtattagttaacaatccagaacaactattagcatataattgttcgccc
tcattcaattggaaaaaaaatctaaacgatagtcaaatagcctcctttcaagaggatatt
gccgccatgggatataagtatcaattcatcactctagctggtattcataatatgtggtat
aacatgtttgaacttgctcatgagtatgctcaaggtgaaggcatgaaacattatgttgaa
aaagttcaggagcctgaatttgcagcagcagaaaagggctacacatttgcttctcatcaa
caagaagtgggggctggttattttgatgatgttactactgttattcaaggcgatacatct
tcggtaaccgccttaacaggttcaacagaggcggcgcaattttaa

DBGET integrated database retrieval system