KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_0538Help
Entry
Rmag_0538         CDS       T00438                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rmag_0538
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rmag_0538
Enzymes [BR:rma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Rmag_0538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
588492..589796
Genome map
AA seq 434 aa AA seqDB search
MNRQEQTNVLTKDWAENPRWKNVKRAYNAKDVVRLRGSIQPEYTYARLGSEKLWKLINDS
SKKGYVNCMGAITAGQAMQQAKAGIEAIYLSGWQVAADGNTSETMYPDQSLYAYDSVPTM
VRRINNTFKRADEIQWAKGINQNDQEYVDYFLPIIADAEAGFGGVLNAYELMKNMIVNGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLTSARLAADVMGIPTIVLARTDAEAATL
LTSDVDPRDERFVTGKRTPEGFYIVKNGLEQAISRGISYAPYADLVWCETGKPDLGFARE
FAQAVLVNNPEQLLAYNCSPSFNWKKNLNDSQIASFQEDIAAMGYKYQFITLAGIHNMWY
NMFELAHEYAQGEGMKHYVEKVQEPEFAAAEKGYTFASHQQEVGAGYFDDVTTVIQGDTS
SVTALTGSTEAAQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaatagacaagaacaaacaaatgtattgacaaaagactgggctgagaatccacgttgg
aaaaatgtgaaacgcgcttataatgcgaaagacgttgtacgtctacgtggctccatacag
cctgaatatacttacgcacgattaggttctgaaaaattatggaaactgattaacgattct
tctaaaaagggttatgttaattgtatgggcgcaatcacagcaggtcaagcgatgcagcaa
gcaaaagcaggtattgaggcaatttatttatcaggttggcaagttgctgctgacggtaac
acatcagaaaccatgtatcctgatcaatccttgtatgcgtatgactcagtaccaacaatg
gtgcgtcgcattaacaatacctttaaacgtgctgatgaaattcagtgggcaaaaggtatc
aatcaaaacgatcaagagtatgttgattattttctacctattattgctgatgctgaggct
gggtttggtggtgtattaaatgcttatgagttgatgaaaaatatgattgtcaatggtgca
gcagccgttcattttgaagatcagttagcttcggttaaaaaatgtggacacatgggtggc
aaggttttagttcccactcaagaagcgattcaaaaactcacttcagcacgcttagcagca
gatgtaatgggtattcctacgattgtattagcacgaactgatgctgaggcagcaacccta
ttaacgtctgatgtagatcctagagatgaaagatttgtgactggtaaacgtactccagaa
ggattttatattgttaaaaatggtcttgagcaagccatttcacgcggtatttcatacgca
ccatatgctgatttagtatggtgtgaaactggaaaaccagatttaggttttgctcgtgaa
tttgctcaagcagtattagttaacaatccagaacaactattagcatataattgttcgccc
tcattcaattggaaaaaaaatctaaacgatagtcaaatagcctcctttcaagaggatatt
gccgccatgggatataagtatcaattcatcactctagctggtattcataatatgtggtat
aacatgtttgaacttgctcatgagtatgctcaaggtgaaggcatgaaacattatgttgaa
aaagttcaggagcctgaatttgcagcagcagaaaagggctacacatttgcttctcatcaa
caagaagtgggggctggttattttgatgatgttactactgttattcaaggcgatacatct
tcggtaaccgccttaacaggttcaacagaggcggcgcaattttaa

DBGET integrated database retrieval system