KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_0538Help
Entry
Rmag_0538         CDS       T00438                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
rma00630  Glyoxylate and dicarboxylate metabolism
rma01100  Metabolic pathways
rma01110  Biosynthesis of secondary metabolites
rma01120  Microbial metabolism in diverse environments
rma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rma00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rmag_0538
Enzymes [BR:rma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Rmag_0538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABL02292
UniProt: A1AWI5
Position
588492..589796
Genome map
AA seq 434 aa AA seqDB search
MNRQEQTNVLTKDWAENPRWKNVKRAYNAKDVVRLRGSIQPEYTYARLGSEKLWKLINDS
SKKGYVNCMGAITAGQAMQQAKAGIEAIYLSGWQVAADGNTSETMYPDQSLYAYDSVPTM
VRRINNTFKRADEIQWAKGINQNDQEYVDYFLPIIADAEAGFGGVLNAYELMKNMIVNGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLTSARLAADVMGIPTIVLARTDAEAATL
LTSDVDPRDERFVTGKRTPEGFYIVKNGLEQAISRGISYAPYADLVWCETGKPDLGFARE
FAQAVLVNNPEQLLAYNCSPSFNWKKNLNDSQIASFQEDIAAMGYKYQFITLAGIHNMWY
NMFELAHEYAQGEGMKHYVEKVQEPEFAAAEKGYTFASHQQEVGAGYFDDVTTVIQGDTS
SVTALTGSTEAAQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaatagacaagaacaaacaaatgtattgacaaaagactgggctgagaatccacgttgg
aaaaatgtgaaacgcgcttataatgcgaaagacgttgtacgtctacgtggctccatacag
cctgaatatacttacgcacgattaggttctgaaaaattatggaaactgattaacgattct
tctaaaaagggttatgttaattgtatgggcgcaatcacagcaggtcaagcgatgcagcaa
gcaaaagcaggtattgaggcaatttatttatcaggttggcaagttgctgctgacggtaac
acatcagaaaccatgtatcctgatcaatccttgtatgcgtatgactcagtaccaacaatg
gtgcgtcgcattaacaatacctttaaacgtgctgatgaaattcagtgggcaaaaggtatc
aatcaaaacgatcaagagtatgttgattattttctacctattattgctgatgctgaggct
gggtttggtggtgtattaaatgcttatgagttgatgaaaaatatgattgtcaatggtgca
gcagccgttcattttgaagatcagttagcttcggttaaaaaatgtggacacatgggtggc
aaggttttagttcccactcaagaagcgattcaaaaactcacttcagcacgcttagcagca
gatgtaatgggtattcctacgattgtattagcacgaactgatgctgaggcagcaacccta
ttaacgtctgatgtagatcctagagatgaaagatttgtgactggtaaacgtactccagaa
ggattttatattgttaaaaatggtcttgagcaagccatttcacgcggtatttcatacgca
ccatatgctgatttagtatggtgtgaaactggaaaaccagatttaggttttgctcgtgaa
tttgctcaagcagtattagttaacaatccagaacaactattagcatataattgttcgccc
tcattcaattggaaaaaaaatctaaacgatagtcaaatagcctcctttcaagaggatatt
gccgccatgggatataagtatcaattcatcactctagctggtattcataatatgtggtat
aacatgtttgaacttgctcatgagtatgctcaaggtgaaggcatgaaacattatgttgaa
aaagttcaggagcctgaatttgcagcagcagaaaagggctacacatttgcttctcatcaa
caagaagtgggggctggttattttgatgatgttactactgttattcaaggcgatacatct
tcggtaaccgccttaacaggttcaacagaggcggcgcaattttaa

DBGET integrated database retrieval system