KEGG   Candidatus Ruthia magnifica: Rmag_0559Help
Entry
Rmag_0559         CDS       T00438                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rma00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rmag_0559 (gmk)
Enzymes [BR:rma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Rmag_0559 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
610988..611599
Genome map
AA seq 203 aa AA seqDB search
MSNGVLFVISAPSGCGKTSLVKALIKKIDHLCVSVSHTTRAPRLGEVQGENYFFVSKDEF
NKIKNNNGFIESAQVFDNDYGSAKQLVQNLLNNDSDVILEIDWQGFRQIKQTFNHSVGIF
ILPPSQAVLKKRLTDRGQDKQSIIGRRMHDADNEMQHFNEFDYLIINDNFDVALNNLSII
VQAERLTLAQQSIKHKDLLKTLI
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatggcgtgttgtttgttatttccgccccttcagggtgtggaaaaacttcatta
gttaaagcgctcattaaaaaaattgatcatttgtgtgtttcagtttcacacaccacaaga
gcgccacgcttaggtgaagtacagggtgaaaactacttttttgtttctaaagatgaattt
aataaaataaaaaataacaacggctttattgaatcagcacaagtgtttgataatgattat
ggtagcgccaaacaattggttcaaaatttgttaaataatgattctgatgttattttagag
attgactggcagggttttagacagattaaacaaacttttaatcactcagttggtattttt
attctcccaccttctcaagcggtattaaaaaaacgcttaaccgatagaggacaagacaaa
caaagtattattggcagaagaatgcatgatgcagacaatgaaatgcaacattttaatgaa
tttgactatctaattattaatgataattttgacgtagctctgaataatttatcaatcatt
gttcaagccgaacgtctaacgttagcacaacaatcaatcaaacacaaagatttgcttaaa
acattgatatag

DBGET integrated database retrieval system