KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_0602Help
Entry
Rmag_0602         CDS       T00438                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rmag_0602 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    Rmag_0602 (hisD)
Enzymes [BR:rma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Rmag_0602 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
658224..659531
Genome map
AA seq 435 aa AA seqDB search
MITKLTSTQSDFQEKLTSLLVCNSFYNKEVTQTVDDIITNVRNNGDSALIDYTNKFDGVN
VSNMKNLTIKLPALKQAFNTLNKKQKSALTIAANRVHLYHEKQKQSTWTYIEDDGTMLGQ
KITPLDRVGLYVPGGKAAYPSSVLMNAIPAKVAGVESLIMVVATPNGISNLLVLAAAYIS
GITQVFTVGGAQAIAALAYGTQTIPKVDKIVGPGNIYVTTAKRAVFGQVGIDMIAGPSEI
LIICDGKTNPDWIAMDLFSQAEHDEDAQSILLCPDTDFINQVEKSIAKLLPTMDRKAIIK
TALKDRGVLIHTKDMNEAITLSNQIAPEHLELSVEDPQVMLNDIKHAGAIFMGRHTCESL
GDYCAGPNHVLPTSGTARFSSPLGVYDFQKKSSLIMVSRQGANTLGKVAAILADGEGLQA
HAQSAKYRIIHQHKI
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
gtgattactaaattaacctcaacacaatctgattttcaagaaaaacttacttcattgctt
gtatgtaatagcttttataacaaagaggtcactcaaacagttgatgatattattactaat
gttcgtaataatggcgacagcgctttaattgattacacaaataaatttgatggtgttaat
gtctctaacatgaaaaatttaactattaaattgcctgcgcttaaacaagcatttaataca
ctaaataaaaagcagaaatccgcactaaccatagcagcaaaccgcgtacacctttaccac
gaaaaacaaaagcaaagcacttggacctatatagaagatgatggcacaatgttgggacaa
aaaatcacaccacttgatcgtgttggtttgtacgttcctggtggaaaagcagcttacccc
tcttctgttttaatgaatgctattccagctaaagttgctggtgtagagtccttaattatg
gttgtggcaacgcccaatggaatcagcaatttattggtattagcagcagcatacatttca
ggcatcactcaagtatttacagtgggtggcgcacaagcaatagcagcacttgcctatggc
acacaaaccataccaaaagtagacaaaattgtaggtcctggtaatatttatgtgacaaca
gccaagcgtgcagtatttggccaagttggtattgatatgattgctggccctagtgagatt
ttaattatttgtgatggaaaaactaatcctgactggattgccatggatttattttctcaa
gcagaacacgatgaagacgcacaatcaatcttattatgtccagatactgactttattaat
caagttgaaaaaagcattgctaaattactacctaccatggatagaaaagccatcattaag
actgcacttaaagaccgtggcgtactcattcacacaaaagatatgaatgaagccattact
ttatctaaccaaattgcacctgaacatttagagctgtctgttgaagatccacaagttatg
ttaaatgacataaaacacgcaggcgcaattttcatgggtcgccacacttgtgaatcatta
ggggattattgtgcagggccaaatcacgtactacccacatcaggaacagcacgcttttca
tcccctttaggtgtgtatgattttcaaaaaaaatcaagtttgattatggtatcacgccaa
ggcgcaaatacattaggtaaagtagctgctattttagcggatggtgagggtttacaggcc
catgctcaatctgcaaaatatcgaataattcatcaacacaaaatatga

DBGET integrated database retrieval system