KEGG   Candidatus Ruthia magnifica: Rmag_0683Help
Entry
Rmag_0683         CDS       T00438                                 

Definition
uracil-DNA glycosylase (EC:3.2.2.-)
Orthology
K03648  
uracil-DNA glycosylase [EC:3.2.2.27]
Organism
rma  Candidatus Ruthia magnifica
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:rma03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
734857..735516
Genome map
AA seq 219 aa AA seqDB search
MNIQNWHPSIKTLLETQSMIDLKRFLQQQKQAKKVILPYSKNWFKAFELTAFYKVKIIIL
GQDPYHGLEQAHGLSFSVVQGVKKPPSLDNIFKELYSDLNIEPNQSSDLTHWATQGVLLL
NSVLTVEAHKAASHANQGWEVFTDSIIKTLSEERQHLVFILWGAYAQKKAIFIDKDKHLI
LTTTHPSPLSAYRGFLGCRHFSKANDYLKMHNQQVISWS
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacaaaactggcatccaagcatcaaaacattgcttgaaacacaatcaatgatt
gatttaaagcgatttttacaacagcaaaaacaagccaaaaaagtcattttaccctattcc
aaaaattggtttaaagcgtttgagttaactgcattttataaagttaagatcattattctt
ggacaagacccttatcatggattggaacaagctcatggtttgagtttttcagtcgtccaa
ggcgtaaaaaagccaccatcacttgacaatatctttaaagaattatatagtgatttaaat
attgagcctaaccaaagtagcgatttaacgcattgggcaacacaaggtgttttactgctt
aatagtgttttaactgttgaagctcacaaggcagcttctcatgctaaccaaggttgggag
gtatttactgatagcattattaaaaccctaagtgaagaaaggcaacatttagtattcata
ctttggggcgcttatgcacagaaaaaagcaatatttattgataaagataagcacttaatc
cttactaccacacacccctctcctttatcagcgtatcgtggttttttaggatgtcggcat
ttttcaaaagccaatgattatcttaaaatgcataatcaacaagtgattagttggtcataa

DBGET integrated database retrieval system