KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_0683Help
Entry
Rmag_0683         CDS       T00438                                 

Definition
uracil-DNA glycosylase (EC:3.2.2.-)
Orthology
K03648  
uracil-DNA glycosylase [EC:3.2.2.27]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:rma00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Rmag_0683
Enzymes [BR:rma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     Rmag_0683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
734857..735516
Genome map
AA seq 219 aa AA seqDB search
MNIQNWHPSIKTLLETQSMIDLKRFLQQQKQAKKVILPYSKNWFKAFELTAFYKVKIIIL
GQDPYHGLEQAHGLSFSVVQGVKKPPSLDNIFKELYSDLNIEPNQSSDLTHWATQGVLLL
NSVLTVEAHKAASHANQGWEVFTDSIIKTLSEERQHLVFILWGAYAQKKAIFIDKDKHLI
LTTTHPSPLSAYRGFLGCRHFSKANDYLKMHNQQVISWS
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacaaaactggcatccaagcatcaaaacattgcttgaaacacaatcaatgatt
gatttaaagcgatttttacaacagcaaaaacaagccaaaaaagtcattttaccctattcc
aaaaattggtttaaagcgtttgagttaactgcattttataaagttaagatcattattctt
ggacaagacccttatcatggattggaacaagctcatggtttgagtttttcagtcgtccaa
ggcgtaaaaaagccaccatcacttgacaatatctttaaagaattatatagtgatttaaat
attgagcctaaccaaagtagcgatttaacgcattgggcaacacaaggtgttttactgctt
aatagtgttttaactgttgaagctcacaaggcagcttctcatgctaaccaaggttgggag
gtatttactgatagcattattaaaaccctaagtgaagaaaggcaacatttagtattcata
ctttggggcgcttatgcacagaaaaaagcaatatttattgataaagataagcacttaatc
cttactaccacacacccctctcctttatcagcgtatcgtggttttttaggatgtcggcat
ttttcaaaagccaatgattatcttaaaatgcataatcaacaagtgattagttggtcataa

DBGET integrated database retrieval system