KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_0770Help
Entry
Rmag_0770         CDS       T00438                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rmag_0770
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rmag_0770
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Rmag_0770
Enzymes [BR:rma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Rmag_0770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
816505..817569
Genome map
AA seq 354 aa AA seqDB search
MRYTGLIEHYKDRLPVDDSTRIISLGEGNTPLIRLENIPKELGKDVDIYIKYEGLNPTGS
FKDRGMTMAVTKAVESGSKAIICASTGNTSASAAAYAARAGIKAFVLIPEGKIALGKLAQ
AMIHDAVIIQIKGNFDDGMRLVKEVAEHTPVSIVNSINPFRLQGQKTAAFEIIEEFGCAP
DYHCLPVGNAGNISAHWMGYTEYHKEGKVNNIPKMIGYQAAGSAPFVKGAMIDNPETIAT
AIRIGHPQSWDLAHKVEKKSNGWFDSLTDEEILNAKKLLTEKEGIFCEPASAISLAGAMR
DIKNGKIENGSKIVCTLTGHGLKDPDIAISHCTNQIININLVMSEVKDTILNNM
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagatataccggtttaattgaacactataaagacagacttcccgtggatgacagcact
cgaattattagtttaggcgagggaaatacaccactcattcggctagaaaatattcctaaa
gaattaggtaaagatgttgatatttatattaaatatgaaggtctaaaccccacgggttca
tttaaagaccgaggtatgactatggcagttaccaaagcagtagaatccggttctaaagca
attatttgtgcttctacaggtaacacctcagcatctgctgcggcttacgctgcgcgtgct
ggtattaaagcgtttgtgttgattcctgaaggaaaaattgcactaggtaaattagcacaa
gcaatgattcatgacgctgttattattcaaattaaaggtaactttgacgatggcatgcgt
ttggttaaagaggtggctgaacatacaccagtatcaattgttaattcaattaatccattt
cgcctacagggtcaaaaaactgctgcctttgaaattatagaagagtttggctgtgcgcca
gattatcattgcctgcctgtgggcaatgcagggaatatttcagcacattggatgggatat
acagaatatcataaagaaggtaaagtaaacaatattcctaaaatgatcggctatcaagca
gcaggctctgcgccttttgttaaaggtgcaatgatagacaacccagaaaccattgcaact
gctattcgtattggccatccacaaagttgggatttggcacacaaagttgaaaaaaaatca
aacggctggtttgattcattaaccgatgaagaaattctaaacgcaaaaaaattactcact
gaaaaagaaggtattttttgcgaaccagcttcagcaatctcactagcaggtgcaatgcgt
gacattaaaaacggaaaaattgaaaatggttctaaaattgtatgcactttaacaggtcat
ggcttaaaagaccctgatatagcaatttcacattgcaccaatcaaataattaacatcaac
ctagtaatgagcgaagtcaaagacactattttaaataatatgtaa

DBGET integrated database retrieval system