KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_0832Help
Entry
Rmag_0832         CDS       T00438                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
rma00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rma01100  Metabolic pathways
rma01110  Biosynthesis of secondary metabolites
rma01130  Biosynthesis of antibiotics
rma01230  Biosynthesis of amino acids
Module
rma_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rma00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rmag_0832
Enzymes [BR:rma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Rmag_0832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ABL02549
UniProt: A1AX92
Position
891934..892731
Genome map
AA seq 265 aa AA seqDB search
MINTSDILKKIIAKKRQEIIQCIKTMPLTEVIEQSKNVPKTRGFYQALKTKVDVKQNAVI
AEIKKSSPSRGVLRKDFNPVEIAKSYELGGATCLSILTDKKFFQGDNQYLINTRIAVSLP
ILRKEFIIDTYQVYETRVMGSDCILLIAACLTDAQMNELSSLAISLSMDVLIEVHNLKEL
KRALKLNLPMIGINNRNLHTFEVSLQTTIDLLKEIKGDTLVITESGILNAENVALMKSNN
IHSYLVGEAFMCQPNPGQTLREIFT
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgataaatacctctgatattttaaaaaaaattattgccaaaaagcggcaagaaattata
caatgcataaaaactatgcctttgacagaggttattgagcaatcaaaaaacgtaccaaaa
acacgtggtttttaccaagcactcaaaactaaagtagatgtcaaacaaaatgctgtcatt
gctgagattaaaaaatcctccccttcaagaggagttttacgtaaagattttaatccagtt
gaaatcgccaaaagttatgaattagggggcgccacttgcttatctattcttactgataaa
aaattttttcaaggtgataatcagtatttaattaatacaagaatagccgtgtcactacca
attttacgcaaagaatttattattgatacttaccaagtttatgaaacacgtgtaatgggt
tcagattgtattttactcatcgctgcttgtttaactgacgcacaaatgaatgagctttca
tcattagcaatctctctaagtatggatgtattaattgaagtgcacaatttaaaagaacta
aaacgcgcactcaaacttaacctgccaatgataggtattaataatcgaaatctacacacg
tttgaagtatctttacaaactacaatagacttattaaaagaaatcaagggagacactttg
gtcatcaccgaaagtggtattttaaacgctgaaaacgtagcactaatgaaatcaaacaat
attcatagttatctggtgggtgaagcgtttatgtgccagcccaatccaggacaaacatta
cgagagatttttacatga

DBGET integrated database retrieval system