KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_0853Help
Entry
Rmag_0853         CDS       T00438                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
rma00860  Porphyrin and chlorophyll metabolism
rma01100  Metabolic pathways
rma01110  Biosynthesis of secondary metabolites
rma01120  Microbial metabolism in diverse environments
Module
rma_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:rma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rmag_0853
Enzymes [BR:rma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Rmag_0853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 DUF2681 HHH_2
Motif
Other DBs
NCBI-ProteinID: ABL02570
UniProt: A1AXB3
Position
complement(911209..911955)
Genome map
AA seq 248 aa AA seqDB search
MNVLLTRPLLQVEELQSMVTKSGNKPLLFPTLKLNSIDAKVENNYYDVIIFISVNAVEYG
LKILKTISYHKIFAVGSATARKLSENDIEIDDFPRKKASSEALLALDSVAQLYHKTILIF
RGQSGREVLKQGLIKQNNQVEYVEVYERVNHNINSLHRQSLDELLSRNEGVISITSIDSM
KLLVKISSQILDVDRLKNYLLVVLSDRIKTYVNSIGFNKVLVTPNTSNNGIISVLTNLNT
LDKPVKYS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgtattattaactagaccacttttacaagtagaagagttacaatctatggtgact
aaaagtggcaataaaccacttttgtttccaacattaaagcttaactctattgatgctaag
gtagaaaataattattatgatgtgattatttttattagtgtcaatgctgttgaatatggc
ttaaaaattcttaaaacaattagttatcataagatttttgcagtgggtagtgctactgct
agaaaattaagcgagaatgatatagagattgatgattttcctagaaaaaaagcttccagt
gaagcgctcttagcacttgatagcgtagctcaattgtatcataaaacaattctaattttt
agaggtcaaagtggtagagaagtcttaaaacaaggactaattaaacaaaataatcaagtt
gaatacgttgaagtgtatgaacgtgtgaatcataatattaactctttacatcgtcaatca
cttgatgaattgttatcaagaaatgaaggcgttattagcattactagtatagatagtatg
aaattactagtgaaaatatccagtcagattcttgatgttgataggcttaaaaactattta
ttagttgttttaagtgatagaataaaaacttatgtcaattcaattggatttaacaaagtg
ctagtcacgccgaatactagtaataatggcattatttcagtattaacaaatcttaataca
cttgacaaaccagtaaaatacagttaa

DBGET integrated database retrieval system