KEGG   Candidatus Ruthia magnifica: Rmag_0885Help
Entry
Rmag_0885         CDS       T00438                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rma  Candidatus Ruthia magnifica
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rma00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rmag_0885
   00052 Galactose metabolism
    Rmag_0885
   00500 Starch and sucrose metabolism
    Rmag_0885
   00520 Amino sugar and nucleotide sugar metabolism
    Rmag_0885
Enzymes [BR:rma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Rmag_0885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
946217..947047
Genome map
AA seq 276 aa AA seqDB search
MIKKCLFPAAGFGTRFLPATKAVPKEMLPILTKPLLQYAVKEALDAGMSNMAIVTGKGKR
AIEDHFDRSLELEMQIQGTQKEVLLKEINAVCNNSTFTYVRQKQMLGLGHAILTGEPLIG
NEPFAVHLADDLCTSENDNVLTQMIQMYNKYQCSIVAIEQVPMDQTHKYGVITGDLVNNT
NDTYRVTSMIEKPNPKDAPTNMAIIGRYILTPDIFNILKQNKPGKDGEIQITDALLTQAK
QGRVIAYKFKGKRFDCGSIQGYVEATNYFAKQQGII
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgtcttttccctgcagcaggctttggtactagattcttaccagctaca
aaagcagtacccaaagaaatgctacctattctgaccaaaccattattacaatatgccgta
aaagaagcacttgatgctggcatgagcaatatggctatcgtcaccggcaaaggtaagcga
gccattgaagaccactttgatcgatctttagagttggaaatgcaaattcaaggtacgcaa
aaagaagtactattaaaagaaattaatgccgtttgtaacaattctacctttacttatgtc
aggcaaaagcaaatgctaggattgggacatgccattctcactggtgaaccgctaattggt
aatgaaccatttgctgtccatctagctgatgatttatgcacatcagaaaatgacaatgta
ctaactcaaatgattcaaatgtacaacaaatatcaatgttcaatcgtggctattgaacaa
gtgcccatggatcaaacacataagtacggcgtaattactggtgacttggttaacaatact
aatgacacataccgtgttactagtatgattgaaaaaccaaatccaaaggatgcacccact
aatatggctatcataggtcgttatatcttaacgccagatatttttaacatcctaaaacaa
aataaacctggcaaagatggtgaaattcaaatcaccgatgcgctactcacccaagcaaaa
caaggcagagtgattgcttataaatttaagggcaagcggtttgattgcggtagtatccaa
ggttatgttgaagcaacaaactactttgctaaacagcaaggtattatttga

DBGET integrated database retrieval system