KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_0885Help
Entry
Rmag_0885         CDS       T00438                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
rma00040  Pentose and glucuronate interconversions
rma00052  Galactose metabolism
rma00500  Starch and sucrose metabolism
rma00520  Amino sugar and nucleotide sugar metabolism
rma01100  Metabolic pathways
rma01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rma00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rmag_0885
   00052 Galactose metabolism
    Rmag_0885
   00500 Starch and sucrose metabolism
    Rmag_0885
   00520 Amino sugar and nucleotide sugar metabolism
    Rmag_0885
Enzymes [BR:rma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Rmag_0885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD Smr
Motif
Other DBs
NCBI-ProteinID: ABL02600
UniProt: A1AXE3
Position
946217..947047
Genome map
AA seq 276 aa AA seqDB search
MIKKCLFPAAGFGTRFLPATKAVPKEMLPILTKPLLQYAVKEALDAGMSNMAIVTGKGKR
AIEDHFDRSLELEMQIQGTQKEVLLKEINAVCNNSTFTYVRQKQMLGLGHAILTGEPLIG
NEPFAVHLADDLCTSENDNVLTQMIQMYNKYQCSIVAIEQVPMDQTHKYGVITGDLVNNT
NDTYRVTSMIEKPNPKDAPTNMAIIGRYILTPDIFNILKQNKPGKDGEIQITDALLTQAK
QGRVIAYKFKGKRFDCGSIQGYVEATNYFAKQQGII
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgtcttttccctgcagcaggctttggtactagattcttaccagctaca
aaagcagtacccaaagaaatgctacctattctgaccaaaccattattacaatatgccgta
aaagaagcacttgatgctggcatgagcaatatggctatcgtcaccggcaaaggtaagcga
gccattgaagaccactttgatcgatctttagagttggaaatgcaaattcaaggtacgcaa
aaagaagtactattaaaagaaattaatgccgtttgtaacaattctacctttacttatgtc
aggcaaaagcaaatgctaggattgggacatgccattctcactggtgaaccgctaattggt
aatgaaccatttgctgtccatctagctgatgatttatgcacatcagaaaatgacaatgta
ctaactcaaatgattcaaatgtacaacaaatatcaatgttcaatcgtggctattgaacaa
gtgcccatggatcaaacacataagtacggcgtaattactggtgacttggttaacaatact
aatgacacataccgtgttactagtatgattgaaaaaccaaatccaaaggatgcacccact
aatatggctatcataggtcgttatatcttaacgccagatatttttaacatcctaaaacaa
aataaacctggcaaagatggtgaaattcaaatcaccgatgcgctactcacccaagcaaaa
caaggcagagtgattgcttataaatttaagggcaagcggtttgattgcggtagtatccaa
ggttatgttgaagcaacaaactactttgctaaacagcaaggtattatttga

DBGET integrated database retrieval system