KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_0956Help
Entry
Rmag_0956         CDS       T00438                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rmag_0956
Enzymes [BR:rma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Rmag_0956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1017885..1018367)
Genome map
AA seq 160 aa AA seqDB search
MANIHINIGSNQSRRKNLSKAIDTIKAMFENTVFSRVYESKAFGFEGNNFYNIGVNVPTN
LTISEVVSIFHKIEDNLGRDRCSSKFSSRLIDLDLILYDMIIDKSHNLPRDDILKYNFVL
MPLAELSPNLTHPQQHKTYTQLRATMDELKSYNIEILNKK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggctaatattcacatcaatattggttcaaatcaaagccgtaggaaaaatttgtctaag
gctattgacactattaaagcaatgtttgaaaacacagttttttctagagtttatgaatct
aaagcctttggttttgaaggtaataatttttataatattggtgttaatgtaccgactaat
ttaacaatttctgaagtagttagtatttttcataaaattgaagataatcttggtagagat
aggtgttcttcaaaattttcatcacgcttaattgaccttgatttaattttgtatgacatg
attattgacaaaagtcacaacctaccaagagatgatattttgaaatataactttgtactt
atgccattggcagaattaagtccaaatttaactcatccacagcagcataaaacttatacg
cagttacgtgcaactatggatgagttaaaatcgtataatattgaaatcttaaacaagaaa
taa

DBGET integrated database retrieval system