KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_0962Help
Entry
Rmag_0962         CDS       T00438                                 

Definition
dehydrogenase catalytic domain-containing protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rmag_0962
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rmag_0962
   00020 Citrate cycle (TCA cycle)
    Rmag_0962
   00620 Pyruvate metabolism
    Rmag_0962
Enzymes [BR:rma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Rmag_0962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1022029..1023537
Genome map
AA seq 502 aa AA seqDB search
MTSIKNITLPDIGDFDKAEVIEILVNIGDKINTDDSIITLESNKVSMEISSPFTGIVTKI
EVNIGDKIKQGSAILSVERKDNKVQNTKNENFKSQIVPVVMPDIGDFDEVEVIEILVSIG
DKLSKEDSIITLESDKASMEIPTPVAGKVIDINVTLGDKISLGALILNIESIGVEKALET
SIETKAQSLVSEPIPTPITTNTNQTVSILPKGNSHASPSIRKLARELGVDLLSVTGTGQK
GRILDADLKDYVKQIMISGNLSSVIPKTPVIDFSKFGDTETLALSRINKLSGKHLTACWL
NIPHVTQFDEVNINQMEAYRQEQKANGIKLTPLVFIMKALVQTLKNHPNFNASLDESGEN
LIIKKYFNLGIAMDTPKGLIVPVIHDVEQKSLFDLAKELFKTSKNIREDKLRPSDMQGAG
LSISSLGGIGGTQFTPIVNAPEVAILGVSRSYFKPTWDGENFTPTLTLPLALSYDHRVID
GAQGGRFMAELNNTLQGMKGIL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtataaaaaatataacattgcctgatattggcgattttgacaaagctgaggta
attgaaattttagtcaacattggcgacaaaataaacactgatgacagcataattacttta
gaaagcaacaaagtttctatggaaatttcaagtccttttacaggtattgtcacaaaaatt
gaagtcaatattggcgacaaaattaaacaaggtagcgctattttgagcgttgaaagaaaa
gataataaagttcaaaataccaaaaatgaaaattttaagtcccaaattgtacccgttgtt
atgcctgatattggtgattttgatgaggttgaagtgattgaaattttagtcagcataggt
gataaactatctaaagaagacagcataataactttagaaagcgataaagcctcaatggaa
atcccaacgccagttgcaggcaaggtcatcgatattaatgttacactgggcgataaaatc
tctttaggtgcattaattcttaacattgaaagtataggcgtagaaaaagcactcgaaaca
tctatcgaaactaaagcgcaaagccttgtgtccgaaccgataccaacacccataacaaca
aatactaatcaaactgtctcaattctacccaaaggcaattcgcacgcttcaccttctatt
cgtaagctggctagagagttgggtgttgatttattatctgtcactggcacagggcaaaaa
ggcagaattttagatgctgaccttaaagactatgttaaacaaataatgatctctggtaat
ttaagcagtgttattcctaaaacaccagtgattgatttttctaaatttggcgacactgaa
acattagcattgtccagaattaacaaattatcaggcaaacatttgactgcctgctggcta
aacatcccccacgttacccaatttgacgaagtcaatattaatcaaatggaagcgtaccga
caagaacaaaaagccaacggtattaaactcacccccttagtttttatcatgaaagcactg
gttcaaacgttaaaaaatcatccaaattttaatgcatcacttgatgagtcaggtgaaaac
ctgattattaaaaagtatttcaatctaggtattgcaatggatacaccaaaaggtttaatt
gtgccagttattcacgatgttgaacaaaaatccttatttgatttggctaaagaacttttt
aaaacttcaaaaaatatacgagaagacaagttaaggccttctgatatgcaaggcgcaggc
ctaagcatttccagcttaggcggtattggtggtacacaattcacccccattgttaatgcg
ccagaagtggctattttaggtgtatcacgctcatatttcaaacccacttgggatggtgaa
aattttacccccactttaacattaccactagcattatcctacgaccaccgcgtgattgat
ggcgcacaaggtggacggtttatggcagagttaaacaacactttgcaaggcatgaaggga
atcctatga

DBGET integrated database retrieval system