KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_0962Help
Entry
Rmag_0962         CDS       T00438                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
rma00010  Glycolysis / Gluconeogenesis
rma00020  Citrate cycle (TCA cycle)
rma00620  Pyruvate metabolism
rma01100  Metabolic pathways
rma01110  Biosynthesis of secondary metabolites
rma01120  Microbial metabolism in diverse environments
rma01130  Biosynthesis of antibiotics
rma01200  Carbon metabolism
Module
rma_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rmag_0962
   00020 Citrate cycle (TCA cycle)
    Rmag_0962
   00620 Pyruvate metabolism
    Rmag_0962
Enzymes [BR:rma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Rmag_0962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 RnfC_N HlyD_D23 HlyD_3 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ABL02670
UniProt: A1AXL3
Position
1022029..1023537
Genome map
AA seq 502 aa AA seqDB search
MTSIKNITLPDIGDFDKAEVIEILVNIGDKINTDDSIITLESNKVSMEISSPFTGIVTKI
EVNIGDKIKQGSAILSVERKDNKVQNTKNENFKSQIVPVVMPDIGDFDEVEVIEILVSIG
DKLSKEDSIITLESDKASMEIPTPVAGKVIDINVTLGDKISLGALILNIESIGVEKALET
SIETKAQSLVSEPIPTPITTNTNQTVSILPKGNSHASPSIRKLARELGVDLLSVTGTGQK
GRILDADLKDYVKQIMISGNLSSVIPKTPVIDFSKFGDTETLALSRINKLSGKHLTACWL
NIPHVTQFDEVNINQMEAYRQEQKANGIKLTPLVFIMKALVQTLKNHPNFNASLDESGEN
LIIKKYFNLGIAMDTPKGLIVPVIHDVEQKSLFDLAKELFKTSKNIREDKLRPSDMQGAG
LSISSLGGIGGTQFTPIVNAPEVAILGVSRSYFKPTWDGENFTPTLTLPLALSYDHRVID
GAQGGRFMAELNNTLQGMKGIL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtataaaaaatataacattgcctgatattggcgattttgacaaagctgaggta
attgaaattttagtcaacattggcgacaaaataaacactgatgacagcataattacttta
gaaagcaacaaagtttctatggaaatttcaagtccttttacaggtattgtcacaaaaatt
gaagtcaatattggcgacaaaattaaacaaggtagcgctattttgagcgttgaaagaaaa
gataataaagttcaaaataccaaaaatgaaaattttaagtcccaaattgtacccgttgtt
atgcctgatattggtgattttgatgaggttgaagtgattgaaattttagtcagcataggt
gataaactatctaaagaagacagcataataactttagaaagcgataaagcctcaatggaa
atcccaacgccagttgcaggcaaggtcatcgatattaatgttacactgggcgataaaatc
tctttaggtgcattaattcttaacattgaaagtataggcgtagaaaaagcactcgaaaca
tctatcgaaactaaagcgcaaagccttgtgtccgaaccgataccaacacccataacaaca
aatactaatcaaactgtctcaattctacccaaaggcaattcgcacgcttcaccttctatt
cgtaagctggctagagagttgggtgttgatttattatctgtcactggcacagggcaaaaa
ggcagaattttagatgctgaccttaaagactatgttaaacaaataatgatctctggtaat
ttaagcagtgttattcctaaaacaccagtgattgatttttctaaatttggcgacactgaa
acattagcattgtccagaattaacaaattatcaggcaaacatttgactgcctgctggcta
aacatcccccacgttacccaatttgacgaagtcaatattaatcaaatggaagcgtaccga
caagaacaaaaagccaacggtattaaactcacccccttagtttttatcatgaaagcactg
gttcaaacgttaaaaaatcatccaaattttaatgcatcacttgatgagtcaggtgaaaac
ctgattattaaaaagtatttcaatctaggtattgcaatggatacaccaaaaggtttaatt
gtgccagttattcacgatgttgaacaaaaatccttatttgatttggctaaagaacttttt
aaaacttcaaaaaatatacgagaagacaagttaaggccttctgatatgcaaggcgcaggc
ctaagcatttccagcttaggcggtattggtggtacacaattcacccccattgttaatgcg
ccagaagtggctattttaggtgtatcacgctcatatttcaaacccacttgggatggtgaa
aattttacccccactttaacattaccactagcattatcctacgaccaccgcgtgattgat
ggcgcacaaggtggacggtttatggcagagttaaacaacactttgcaaggcatgaaggga
atcctatga

DBGET integrated database retrieval system