KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_1025Help
Entry
Rmag_1025         CDS       T00438                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rmag_1025 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rmag_1025 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rmag_1025 (trpA)
Enzymes [BR:rma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rmag_1025 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1104903..1105700)
Genome map
AA seq 265 aa AA seqDB search
MSRLSTIFTQLPVGKKVFIPFITAGDSGLDNTFELMQVLVKNGADVIELGVPFSDPIADG
PIIAKSHERAVADGVGLCDVLSLVKKFRQSNDTTAIVLMGYLNPIEAFGYQAFANAASES
AVDGVLVVDMPPEEAHDLKRSLDDVNIDLIFLVALTTTDERLAFLATIASGFIYFISLKG
VTGAEHLDVDLVKMYLLRVRKMINLPIGVGFGIKNAKSAKAVSKYADAVIVGSLLVAFVE
QYANDRNKMLANVGYFADEISTAIK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaggttaagtacaatttttacccagcttcctgttggcaaaaaagtatttattccc
tttattactgcgggggatagtgggcttgataatacttttgaactaatgcaagttttggtc
aaaaatggtgcggatgtgattgaattgggtgtgccattttcagatccaatagctgatggc
cctataattgctaagtctcatgaacgagcggtggcagatggggtgggtttgtgtgatgtg
ctaagtctagttaaaaagtttagacaaagcaacgatacaaccgccattgtgttaatgggc
tatcttaatccaattgaggcttttggttatcaagcctttgctaatgctgctagtgaaagc
gctgttgacggtgtgttggtggtagatatgccaccagaagaggcgcatgatttaaagcgg
agtcttgatgatgttaatattgaccttatctttttggttgcactaacaacaacggatgaa
cgcttggcatttttagctaccattgcctcaggttttatttattttatttcccttaaaggt
gtgacaggtgcagagcatttggatgttgatttagtaaaaatgtaccttttaagagttcgt
aaaatgattaatttgcctattggggtaggttttggtattaaaaatgctaaaagtgcaaaa
gcagtgtctaagtatgcagatgcagttattgtaggttcattactggttgcgtttgttgaa
caatatgcaaatgataggaataaaatgttagcaaatgttggatattttgcagatgaaatt
tctactgcaattaaataa

DBGET integrated database retrieval system