KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_1031Help
Entry
Rmag_1031         CDS       T00438                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rmag_1031
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rmag_1031
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rmag_1031
Enzymes [BR:rma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rmag_1031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1112002..1113207)
Genome map
AA seq 401 aa AA seqDB search
MSSYNLPDDKGHFEQYGGIFTAETLMIAVTELKDAYAKFKDDEDFIREFEQDLKHYVGRE
TPLYHAQNLSKKLDGAQIYLKREDLNHTGAHKINNTIGQALLAKRMGKTRIIAETGAGQH
GVATATVAARLGLECVVYMGEVDVARQALNVFRMKLLGATVIPVTLGSKTLKDSINEAMR
DWVTNIDDTFYIIGTVVGPHPYPMMVRDFQSIIGKETKVQFAAQVGGLPDVLVACVGGGS
NAIGLFHAFIDDASVEIYGVEAAGYGLEKGPTAHSAPLCAGSVGVLHGNRTYLMEDENGQ
IIEGHSISAGLDYPGVGPEHAYLKDSGRARYVAITDKEALEAFHVLTKVEGILPALESSH
AVAYGIKLAKELGKDKHIIINLSGRGDKDIHTIAQIEGIEF
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagtagttacaatttaccagatgataagggtcattttgagcaatatggcggtattttt
actgcagaaacactcatgatagctgttactgaactcaaagatgcttatgctaagtttaaa
gatgatgaagattttattcgtgagtttgaacaggatttaaagcattatgtaggtcgtgaa
acgccactttatcatgcacaaaatttaagcaagaaattggatggcgctcagatttatctt
aaacgtgaagatttaaatcatacgggtgcacataaaattaacaacaccattggtcaggca
ctacttgctaagcgtatgggtaaaacacgcattattgctgaaacgggtgctggtcagcat
ggagtggcaacggcaacggttgcagcgcgtctggggctagaatgtgtggtttatatgggt
gaggtggatgtggctcgccaagcgctcaacgtttttcgcatgaagttgttaggtgctacg
gttattccagttactttaggttcaaaaacacttaaagactcaattaatgaagcgatgcgc
gattgggtgacgaatattgatgatacgttctatattattggtacagtcgtaggtccacat
ccttacccaatgatggtacgagattttcaaagtattattggtaaagaaacaaaagtacaa
tttgctgcacaagtgggtggtttgcctgatgttttggtagcttgtgtgggtggtggttca
aatgcgattggtttgtttcatgcatttattgatgacgcctcagttgaaatctatggtgtt
gaggcagcaggatatggtttagaaaaaggtccaactgcacattccgctccactttgtgca
ggtagtgtgggtgttttacacggtaatcgtacttatttaatggaagatgaaaatggacaa
attattgaaggacattcaatctcggcaggtcttgattatcctggtgttggtccagaacat
gcatatttaaaagatagtgggcgtgcacgatacgtggcaattactgataaagaggcatta
gaagcatttcatgtactcaccaaagttgaaggtattttgccagcattggaatcttctcat
gctgtggcttatggtattaaacttgcaaaagaattaggtaaagataaacatatcattatt
aacctttcaggccgtggtgataaggatattcatactattgcacaaattgaaggcattgaa
ttttaa

DBGET integrated database retrieval system