KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_1031Help
Entry
Rmag_1031         CDS       T00438                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
rma00260  Glycine, serine and threonine metabolism
rma00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rma01100  Metabolic pathways
rma01110  Biosynthesis of secondary metabolites
rma01130  Biosynthesis of antibiotics
rma01230  Biosynthesis of amino acids
Module
rma_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rma00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rmag_1031
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rmag_1031
Enzymes [BR:rma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rmag_1031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABL02736
UniProt: A1AXS9
Position
complement(1112002..1113207)
Genome map
AA seq 401 aa AA seqDB search
MSSYNLPDDKGHFEQYGGIFTAETLMIAVTELKDAYAKFKDDEDFIREFEQDLKHYVGRE
TPLYHAQNLSKKLDGAQIYLKREDLNHTGAHKINNTIGQALLAKRMGKTRIIAETGAGQH
GVATATVAARLGLECVVYMGEVDVARQALNVFRMKLLGATVIPVTLGSKTLKDSINEAMR
DWVTNIDDTFYIIGTVVGPHPYPMMVRDFQSIIGKETKVQFAAQVGGLPDVLVACVGGGS
NAIGLFHAFIDDASVEIYGVEAAGYGLEKGPTAHSAPLCAGSVGVLHGNRTYLMEDENGQ
IIEGHSISAGLDYPGVGPEHAYLKDSGRARYVAITDKEALEAFHVLTKVEGILPALESSH
AVAYGIKLAKELGKDKHIIINLSGRGDKDIHTIAQIEGIEF
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagtagttacaatttaccagatgataagggtcattttgagcaatatggcggtattttt
actgcagaaacactcatgatagctgttactgaactcaaagatgcttatgctaagtttaaa
gatgatgaagattttattcgtgagtttgaacaggatttaaagcattatgtaggtcgtgaa
acgccactttatcatgcacaaaatttaagcaagaaattggatggcgctcagatttatctt
aaacgtgaagatttaaatcatacgggtgcacataaaattaacaacaccattggtcaggca
ctacttgctaagcgtatgggtaaaacacgcattattgctgaaacgggtgctggtcagcat
ggagtggcaacggcaacggttgcagcgcgtctggggctagaatgtgtggtttatatgggt
gaggtggatgtggctcgccaagcgctcaacgtttttcgcatgaagttgttaggtgctacg
gttattccagttactttaggttcaaaaacacttaaagactcaattaatgaagcgatgcgc
gattgggtgacgaatattgatgatacgttctatattattggtacagtcgtaggtccacat
ccttacccaatgatggtacgagattttcaaagtattattggtaaagaaacaaaagtacaa
tttgctgcacaagtgggtggtttgcctgatgttttggtagcttgtgtgggtggtggttca
aatgcgattggtttgtttcatgcatttattgatgacgcctcagttgaaatctatggtgtt
gaggcagcaggatatggtttagaaaaaggtccaactgcacattccgctccactttgtgca
ggtagtgtgggtgttttacacggtaatcgtacttatttaatggaagatgaaaatggacaa
attattgaaggacattcaatctcggcaggtcttgattatcctggtgttggtccagaacat
gcatatttaaaagatagtgggcgtgcacgatacgtggcaattactgataaagaggcatta
gaagcatttcatgtactcaccaaagttgaaggtattttgccagcattggaatcttctcat
gctgtggcttatggtattaaacttgcaaaagaattaggtaaagataaacatatcattatt
aacctttcaggccgtggtgataaggatattcatactattgcacaaattgaaggcattgaa
ttttaa

DBGET integrated database retrieval system