KEGG   Candidatus Ruthia magnifica (Calyptogena magnifica): Rmag_1076Help
Entry
Rmag_1076         CDS       T00438                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rma  Candidatus Ruthia magnifica (Calyptogena magnifica)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rmag_1076 (tpiA)
   01230 Biosynthesis of amino acids
    Rmag_1076 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rmag_1076 (tpiA)
   00051 Fructose and mannose metabolism
    Rmag_1076 (tpiA)
   00562 Inositol phosphate metabolism
    Rmag_1076 (tpiA)
Enzymes [BR:rma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Rmag_1076 (tpiA)
Exosome [BR:rma04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Rmag_1076 (tpiA)
  Exosomal proteins of bladder cancer cells
   Rmag_1076 (tpiA)
  Exosomal proteins of melanoma cells
   Rmag_1076 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1159520..1160266)
Genome map
AA seq 248 aa AA seqDB search
MRQIIIAGNWKMNASKEATNTLVIGILSGMADVKSKVIVCVPSLYMSQVEVLVVDSQLNL
GAQNLNVNKLGAFTGEISADMIKDFGAKYVIVGHSERRSLYGETDEIVAQKVQVALDNNL
TPLFCIGELLEDRESNNTKSVVSKQIQVVIDRVGIEAFKNIIVAYEPVWAIGTNVTATPQ
QAQDTHAFIRSMLAEYDADIAQITSILYGGSMNSRNAAELLNCKDIDGGLIGGASLKAQD
FLQICKAG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaaataatcatagcgggtaattggaaaatgaatgcctcaaaagaagcgaccaat
acattggttataggtattctttcaggcatggcagatgttaaatccaaagtcatcgtttgt
gtgccttcactttatatgtcacaggttgaagtattggttgtagattcacaacttaattta
ggtgcacaaaacttaaatgtcaataaattaggtgcttttacgggtgaaattagtgctgat
atgattaaagattttggtgcaaaatacgttattgtaggtcattcagagcgtagaagtctt
tatggtgaaaccgatgagattgttgcgcaaaaagtacaagttgcattggataataattta
accccacttttctgtatcggtgaattgttagaagatagagagtctaataatacgaaatcg
gttgtttcaaaacaaattcaagtagtgattgatcgggttggtattgaggcgtttaaaaat
attattgtggcttatgagcctgtttgggcaattggtacaaatgttaccgcaacgccacag
caagcacaagatacacatgcctttattcgctcaatgttagctgaatacgacgctgatatt
gcacaaataacctcaattctttatggcggtagcatgaattctagaaacgcagctgaatta
cttaattgtaaagatattgatggcggtctaataggtggtgcttcacttaaagcacaagat
ttcttacaaatttgtaaagcaggttaa

DBGET integrated database retrieval system