KEGG   Cupriavidus metallidurans: Rmet_0018Help
Entry
Rmet_0018         CDS       T00351                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00480  Glutathione metabolism
rme00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Rmet_0018
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Rmet_0018
Enzymes [BR:rme01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Rmet_0018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ABF06904
JGI: Rmet0018
UniProt: Q1LSH2
Position
22066..22692
Genome map
AA seq 208 aa AA seqDB search
MSRQRTLESVQRTALAGALTLAAAVAVMLPPPAHAAEKAVPAAAQPAGNCPASLNFRFPR
LQDESPQNLCQYAGKVVLVVNTASYCGFTPQYEGLEALYAKYRERGLVVLGFPSNDFSQE
PGSSKDIADFCYNTYGVKFPMLGKSHVRGSDANPMYALLAQETGTAPKWNFYKYLIDRKG
QVIGSYNSMVKPDDKQFVSKIEELLNAR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgccaacgtaccctggaatccgtgcaacgaaccgctctggctggcgcgctgacg
ctggctgccgccgtggcagtcatgctgccgccacctgctcacgccgccgaaaaggccgtg
ccggcggccgcgcagccggcgggcaattgcccggcgtcgttgaacttccgcttcccgcgg
ctccaggacgaatcgccgcagaacctgtgccagtacgctggcaaggtggtgctggtcgtg
aacacggccagctattgcggcttcacgccgcagtacgagggccttgaggcgctctacgcc
aagtaccgcgaacgcgggctggtggtgctcggtttcccgtccaacgacttttcccaggaa
cccggctcgtccaaggacattgcagacttttgctacaacacctacggggtcaagttcccg
atgctcggcaagagccatgtgcgcggcagcgacgccaatccgatgtacgcactgctggcc
caggagacgggcaccgcgccgaagtggaacttctacaagtacctgatcgaccgcaagggg
caggtcatcggcagctacaacagcatggtcaagccggacgacaagcagtttgtctcgaag
atcgaagaactgctgaacgcgcgctga

DBGET integrated database retrieval system