KEGG   Cupriavidus metallidurans: Rmet_0106Help
Entry
Rmet_0106         CDS       T00351                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rme  Cupriavidus metallidurans
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rmet_0106 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    Rmet_0106 (atoB)
   00640 Propanoate metabolism
    Rmet_0106 (atoB)
   00650 Butanoate metabolism
    Rmet_0106 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    Rmet_0106 (atoB)
   00072 Synthesis and degradation of ketone bodies
    Rmet_0106 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rmet_0106 (atoB)
   00310 Lysine degradation
    Rmet_0106 (atoB)
   00380 Tryptophan metabolism
    Rmet_0106 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rmet_0106 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rmet_0106 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rmet_0106 (atoB)
Enzymes [BR:rme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Rmet_0106 (atoB)
Exosome [BR:rme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rmet_0106 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
113259..114443
Genome map
AA seq 394 aa AA seqDB search
MQKDPVVIVSAVRTPMGAFQSELSSLMAPQLGAAAIRAAVERAGIKPEQVQEVVFGCVLP
AGQGQAPARQAALGAGLPLDVACTTVNKMCGSGMRAAMSVYDGLLAGSFDIAVAGGMESM
TNAPYLVPKARGGYRIGHGMIYDHMMLDGLEDAYDKGRAMGTFGEDCAAKYHFTREQQDA
FAMESVRRAQRATEQGDFRWEIVPVTVSGKGGDTVIDTDEGPRRIKVDKIPSLKPAFAKD
GTITAASSSSINDGASALVMMRESTAKSLGLQPIARMLGHTSHAQAPGWFTTAPVEAIAK
LYRKLDWNTGSVDLFEINEAFAVVPMAAMHDLDIPRDKVNIHGGACALGHPIGASGARIM
TTLIGALRKTGGKRGVASLCIGGGEATAVGIELY
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaggacccagtcgttatcgtttccgcggtgcgtaccccgatgggtgcgttccag
agtgaactgagcagtctgatggcgccgcagcttggcgccgccgcgatccgcgcggcggtt
gagcgcgcgggcatcaagcctgagcaggtgcaggaggtggtgttcggctgtgtgctgcca
gccggacagggtcaggcgcccgcccgacaggccgcgcttggcgcgggcctgccgctcgac
gtggcgtgtaccaccgtcaacaagatgtgcggctccggcatgcgtgcggcgatgagcgtc
tacgacggcctgctggccggatcgttcgatatcgccgtggccggcggcatggaaagcatg
accaacgcgccatacctggtgccgaaggcgcgtggtggctatcgcatcggccacggcatg
atctacgaccacatgatgctggacggcctggaggacgcgtacgacaagggccgggccatg
ggcactttcggcgaggactgcgccgccaagtaccacttcacgcgcgaacagcaggatgcg
ttcgcgatggagtcggtgcgccgcgcccagcgtgccaccgagcagggcgacttccgctgg
gagatcgtgccggtgacggtgtcgggcaagggtggcgataccgtcatcgacaccgatgag
gggccgcgccgcatcaaggtcgacaagatcccgtcgctgaagccggcgtttgccaaggac
ggcacgattaccgctgcgtcgtcgtcgtcgatcaatgacggcgcctcggcgctggtgatg
atgcgcgaatccaccgcgaaatcgctcgggttgcagccaatcgccagaatgctcggccat
acctcccacgcacaggcgccgggctggttcaccaccgcgccggtggaggccatcgccaag
ctgtatcgcaagctcgactggaacactggcagcgtcgatctgttcgaaatcaacgaggcc
tttgccgtggtgccgatggccgcgatgcacgatctcgacattccgcgcgacaaggtcaac
atccatggcggcgcatgcgcgctgggccatccgatcggcgcgtccggcgcacgtatcatg
accacgctgatcggcgcattgcgcaagaccggcggcaagcgcggcgtggccagcctctgc
atcggcggcggcgaagccactgcggtcggcatcgaactctactga

DBGET integrated database retrieval system