KEGG   Cupriavidus metallidurans: Rmet_0251Help
Entry
Rmet_0251         CDS       T00351                                 

Gene name
gpmA
Definition
phosphoglyceromutase 1 (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rme  Cupriavidus metallidurans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rmet_0251 (gpmA)
   01230 Biosynthesis of amino acids
    Rmet_0251 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rmet_0251 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Rmet_0251 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rmet_0251 (gpmA)
Enzymes [BR:rme01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Rmet_0251 (gpmA)
Exosome [BR:rme04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Rmet_0251 (gpmA)
  Exosomal proteins of melanoma cells
   Rmet_0251 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(267833..268579)
Genome map
AA seq 248 aa AA seqDB search
MYKLVLIRHGESTWNLENRFTGWVDVDLTDTGAAQAKQAGTLLKEAGFAFDVAYTSVLKR
AIRTLWHVQDEMDLMWIPVRNEWRLNERHYGALAGLNKAETAKKYGDEQVLVWRRSYDTP
PPALEPTDERASFGDPRYANVPRAEIPLTECLKDTVARVMPLWNESIAPDIKSGKRVVIA
AHGNSIRALVKYLDQISDDDIVGLNIPNGTPLVYELDADLRPLRHYYLGDQEAIAASLAA
VASQGKAR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagctcgttctcatccgccacggcgaatccacgtggaacctcgaaaaccgcttc
accggctgggtcgacgtcgacctgaccgatacgggcgccgcgcaggccaaacaggccggc
acgctgctcaaggaagccggcttcgcctttgacgtggcctacacctccgtgctcaagcgc
gccatccgcacgctctggcacgtgcaagacgaaatggacctgatgtggattccggtgcgc
aatgaatggcgcctgaacgaacgtcactacggcgcgctggccggcctgaacaaggcggaa
acggccaagaagtacggcgacgagcaggtgctggtgtggcgccgcagctacgacacgccg
ccgcccgcgctggagccgaccgacgaacgtgcctctttcggcgacccgcgctacgccaat
gtgccgcgcgcggagatcccgctgaccgagtgcctgaaggacacggtggcccgcgtgatg
ccgctgtggaacgaatccattgctcccgacatcaaatccggcaagcgcgtggtgatcgcc
gcccatggcaacagcattcgcgccctcgtaaagtatctggaccagatttcggatgacgat
atcgtcggcctcaatatccccaatggcaccccgctcgtctacgagctggatgccgacctg
cgccccctgcgccactactacctgggcgaccaggaagccatcgcggcgtccctggccgcc
gtggccagccagggcaaggcccgctga

DBGET integrated database retrieval system