KEGG   Cupriavidus metallidurans: Rmet_0251Help
Entry
Rmet_0251         CDS       T00351                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00010  Glycolysis / Gluconeogenesis
rme00260  Glycine, serine and threonine metabolism
rme00680  Methane metabolism
rme01100  Metabolic pathways
rme01110  Biosynthesis of secondary metabolites
rme01120  Microbial metabolism in diverse environments
rme01130  Biosynthesis of antibiotics
rme01200  Carbon metabolism
rme01230  Biosynthesis of amino acids
Module
rme_M00002  Glycolysis, core module involving three-carbon compounds
rme_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rmet_0251 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Rmet_0251 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rmet_0251 (gpmA)
Enzymes [BR:rme01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Rmet_0251 (gpmA)
Membrane trafficking [BR:rme04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Rmet_0251 (gpmA)
Exosome [BR:rme04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Rmet_0251 (gpmA)
  Exosomal proteins of melanoma cells
   Rmet_0251 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABF07137
JGI: Rmet0251
UniProt: Q1LRT9
Position
complement(267833..268579)
Genome map
AA seq 248 aa AA seqDB search
MYKLVLIRHGESTWNLENRFTGWVDVDLTDTGAAQAKQAGTLLKEAGFAFDVAYTSVLKR
AIRTLWHVQDEMDLMWIPVRNEWRLNERHYGALAGLNKAETAKKYGDEQVLVWRRSYDTP
PPALEPTDERASFGDPRYANVPRAEIPLTECLKDTVARVMPLWNESIAPDIKSGKRVVIA
AHGNSIRALVKYLDQISDDDIVGLNIPNGTPLVYELDADLRPLRHYYLGDQEAIAASLAA
VASQGKAR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagctcgttctcatccgccacggcgaatccacgtggaacctcgaaaaccgcttc
accggctgggtcgacgtcgacctgaccgatacgggcgccgcgcaggccaaacaggccggc
acgctgctcaaggaagccggcttcgcctttgacgtggcctacacctccgtgctcaagcgc
gccatccgcacgctctggcacgtgcaagacgaaatggacctgatgtggattccggtgcgc
aatgaatggcgcctgaacgaacgtcactacggcgcgctggccggcctgaacaaggcggaa
acggccaagaagtacggcgacgagcaggtgctggtgtggcgccgcagctacgacacgccg
ccgcccgcgctggagccgaccgacgaacgtgcctctttcggcgacccgcgctacgccaat
gtgccgcgcgcggagatcccgctgaccgagtgcctgaaggacacggtggcccgcgtgatg
ccgctgtggaacgaatccattgctcccgacatcaaatccggcaagcgcgtggtgatcgcc
gcccatggcaacagcattcgcgccctcgtaaagtatctggaccagatttcggatgacgat
atcgtcggcctcaatatccccaatggcaccccgctcgtctacgagctggatgccgacctg
cgccccctgcgccactactacctgggcgaccaggaagccatcgcggcgtccctggccgcc
gtggccagccagggcaaggcccgctga

DBGET integrated database retrieval system