KEGG   Cupriavidus metallidurans: Rmet_0469Help
Entry
Rmet_0469         CDS       T00351                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00020  Citrate cycle (TCA cycle)
rme00640  Propanoate metabolism
rme00660  C5-Branched dibasic acid metabolism
rme01100  Metabolic pathways
rme01110  Biosynthesis of secondary metabolites
rme01120  Microbial metabolism in diverse environments
rme01130  Biosynthesis of antibiotics
rme01200  Carbon metabolism
Module
rme_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rme_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rmet_0469 (sucC)
   00640 Propanoate metabolism
    Rmet_0469 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Rmet_0469 (sucC)
Enzymes [BR:rme01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Rmet_0469 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABF07355
JGI: Rmet0469
UniProt: Q1LR71
Position
498381..499547
Genome map
AA seq 388 aa AA seqDB search
MNIHEYQGKEILRKYNVPVPRGIPAFSVEEALKAAEQLGGPVWVVKAQIHAGGRGKGGGV
KVAKSIDEVKTYATNILGMTLVTHQTGPEGKKVNRLLIEEGADIKKELYVSLVVDRVSQK
VALMASSEGGMDIEEVAAHTPEKIHTLIIEPSEGLKDSDADDIARKIGVPDASVPQARQA
LQGLYKAFWDTDASLAEINPLILTGDGKVVALDAKFNFDSNALFRHPEIVAYRDLDEEDA
NEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATTEKVTE
AFKLMLKNPNVQAILVNIFGGIMRCDVIAEGVITASKAVQLGVPLVVRMKGTNEELGRKM
LADSGLPIISADTMEEAAQKVVAAVAGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtatcaaggcaaggaaatcctgcgcaaatacaatgtgccggttccg
cgcggcatccctgctttctcggttgaagaagccctgaaggcggctgaacagctcggcggc
ccggtgtgggtcgtcaaggcgcagatccacgcaggcggccgcggcaagggcggcggcgtg
aaggtggccaagagcatcgacgaggtgaagacctacgccaccaacattctcggcatgacg
ctggtgacgcaccagaccggcccggaaggcaagaaggtcaatcgcctgctgatcgaagaa
ggcgctgacatcaagaaggaactctacgtttcgctggtggtggaccgcgtgtcgcagaag
gtggccctgatggcctcgagcgaaggcggcatggacatcgaggaagtcgctgcccacacc
ccggaaaagatccacacgctgatcatcgaaccgtcggaaggcctgaaggattcggacgct
gacgacatcgcccgcaagatcggcgtgcccgacgccagcgttccccaggctcgccaggcc
ctgcaaggcctgtacaaggcattctgggacaccgacgcctcgctggccgaaatcaacccg
ctgatcctgaccggcgacggcaaggtcgttgccctggacgccaagttcaacttcgactcg
aacgcgctgttccgtcacccggaaatcgtcgcgtaccgtgacctggacgaagaagacgcc
aacgaaatcgaggcctcgaagttcgatctggcctacatctcgctggacggcaacatcggc
tgcctggtgaacggcgctggcctggccatggccacgatggacaccatcaagctgttcggt
ggcgagccggccaacttcctcgacgtgggtggcggcgccaccaccgagaaggtgaccgaa
gccttcaagctgatgctgaagaacccgaacgtgcaggccatcctggtcaacatcttcggc
ggcatcatgcgttgcgacgtgatcgccgaaggcgtgatcaccgcttcgaaggccgtgcag
cttggcgtgccgctggtcgtccgcatgaagggcacgaacgaagagctgggccgcaagatg
ctggctgattccggtctgccgatcatctcggccgacacgatggaagaagccgcccagaag
gtcgtggccgccgtcgctggcaagtaa

DBGET integrated database retrieval system