KEGG   Cupriavidus metallidurans: Rmet_0604Help
Entry
Rmet_0604         CDS       T00351                                 

Definition
putative esterase (EC:3.1.1.23)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
rme  Cupriavidus metallidurans
Brite
Enzymes [BR:rme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Rmet_0604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
653264..654487
Genome map
AA seq 407 aa AA seqDB search
MTTQQAPRIGALLIHGLGGTQYDLGPMHKVLRRAGVETHAVTLPGHGGVPEDLLPVVAEQ
WIDVVTQAYDELVGQYDTFHVIGMCMGALLALELVARRQHRKGQLVALAAPVYIDGWSTP
SYRWLRHVVYHLPGLPTRIKVEENEPFGIKNDLVRAIVKAKFERGDNFHYRWVPLTCIRQ
VDRLRRWVLDSAHRVPCPTLVVNAREDELTTLRSYDFLLGAVPQVRGVVLENSYHMICVD
NDREQVIASVLEFLGLEASAGRPRARRSVEMPMAAEAVATLVGEYLSALTTRHFETVYPL
LDPAIEWRHLGEHPLAGVYADRDAVIGLFQRVEQLAGDSVRIEVAGAPRIDGQTVEIDIA
ASYRFDGQPMDGRGTQTLRLANGRIRAVEYRPESAADSDAPLVRQAG
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgcaacaggctccacgcatcggagccctgctgattcacggcttgggcggtacc
cagtacgacctcgggccgatgcacaaggtgctgcgccgcgcgggcgtggagacgcacgcc
gtcacgctgcccggtcatggcggcgtgcccgaggacctgttgcccgtggtggcggagcag
tggattgacgtggtgacccaggcctacgacgaactggtcggccagtacgacacgtttcat
gtcatcggcatgtgcatgggagcgctgctcgcgctggaactggtcgcgcggcgccagcat
cgcaagggccaactggtggcgctggccgccccggtctatatcgacggctggtccacgccg
tcctaccgctggctgcggcacgtggtctatcacctgccggggctgcccacgcgtatcaag
gtggaggagaacgagccgttcggcatcaagaacgacctggtgcgcgccatcgtcaaggcc
aagttcgagcgcggcgacaacttccactatcgctgggtgccgttgacctgcatccggcag
gtggaccgtctgcgccgctgggtgctggacagcgcgcaccgcgtgccttgcccgacgctg
gtcgtcaacgcgcgcgaggacgagctgaccacgttgcgctcgtacgatttcctgctcggc
gcggtgccgcaggtgcggggtgtggtgctcgagaacagctatcacatgatctgtgtggat
aacgatcgcgagcaggtcatcgccagcgtgctcgagttcctggggctggaggcgtccgcc
ggcagaccccgcgcgcgtcggtcggtggagatgccgatggctgcggaagccgtcgccacg
ctggtgggcgagtatctctccgcgctgaccacgcggcatttcgagaccgtctatccgctg
ctcgatccggccattgaatggcgccatctgggtgagcatccgctggcaggggtctatgca
gaccgggatgccgtgatcggtctgttccagcgcgtggagcaactggctggcgatagcgta
cggatcgaggtggccggcgcgccgcgcatcgacggccagacggtggaaatcgacatcgcg
gcgtcgtaccggttcgacggtcagccgatggatggccgtggcacgcagacgctacgacta
gccaacggccgcatccgcgcggtcgagtaccgtcccgaatcggcggcggacagcgatgcg
ccgctggtccgccaggcgggctag

DBGET integrated database retrieval system