KEGG   Cupriavidus metallidurans: Rmet_0719Help
Entry
Rmet_0719         CDS       T00351                                 

Gene name
aroA
Definition
3-phosphoshikimate 1-carboxyvinyltransferase (EC:2.5.1.19)
Orthology
K00800  
3-phosphoshikimate 1-carboxyvinyltransferase [EC:2.5.1.19]
Organism
rme  Cupriavidus metallidurans
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rme01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:rme00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
796526..797884
Genome map
AA seq 452 aa AA seqDB search
MPPARAARNGHAAENMEQLTLGPLTRASGTVRLPGSKSISNRVLLLSALATGETRVRDLL
DSDDTRVMLEALKVLGVAWRREGNDCIVSGVGGNFPSKAADLFMGNAGTAIRPLTAALAL
QGGTYKLSGVQRMHERPIGDLVDGLRQVGASVDYLGTPGYPPLQINPAQIRIDAPIRVRG
DVSSQFLTALLMTLPMAQAQSGRIEIEVVGELISKPYIEITLNLLSRFGIAVERQGWERF
ILPAGARYRSPGEIYVEGDASTASYFLAAGAIGGGPVRVEGVGMASIQGDVRFADALNRM
GANVMAGDNWIEVRGTERDDGRLNGIELDCNHIPDAAMTLAVAALFAEGTTTLTNIASWR
VKETDRISAMATELRKLGAEVEEGADYLKVTPPTSPATWQTPDAGIGTYDDHRMAMCFSL
AAFGPLPVKINDPGCVAKTFPEYFEVFAGVAR
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgccgccagcgcgcgcggcgcgcaacggccatgctgcagaaaacatggaacaactgacc
ctcggccccctgacccgtgcttccggcacggtgcgcctgcccggctccaagagcatctcc
aaccgcgtgctgctgctgtccgcgctcgccaccggcgaaacgcgcgtccgcgacctgctc
gattccgacgacacgcgtgtcatgctcgaagcgctcaaggtgctcggcgtggcatggcgg
cgcgagggcaacgactgcatcgtgtccggcgtgggcggaaatttcccgagcaaggcggca
gacctgttcatgggtaatgccggcacggcaatccggccattgaccgcggcactggcgctg
caaggcggtacgtacaagctgagcggcgtgcagcggatgcatgaacggccgatcggcgat
ctggtcgatggcctgcggcaggtcggcgcatcggtggattacctgggcacgcccggctac
ccgcctttgcagatcaacccagcgcagattcgcattgatgcaccgatccgtgtgcgcggc
gatgtatcgagccagttcctgaccgcgctgttgatgacgttgccaatggcccaggcacaa
tcgggtcgcattgagatcgaagtggtcggcgaattgatttcgaagccgtatatcgagatc
acgctgaacttgctgtcgcgcttcggtattgccgtcgagagacagggctgggagcgcttt
atcctgccggccggcgcgcggtaccgttcgccgggcgagatctacgtcgaaggcgatgcg
tccacggcatcgtacttcctggcggcgggcgccatcggtggtggcccggtacgcgtggag
ggtgtgggcatggcgagtatccagggcgatgttcggtttgccgatgcgctgaaccggatg
ggcgccaacgtgatggctggtgacaactggattgaagtgcgcggcacagagcgtgacgac
ggccgactcaacggcatcgagctcgactgcaatcacattcctgatgcggcgatgacgctg
gccgtggccgcgctgttcgcggagggcaccaccacgctgaccaacatcgccagctggcgg
gtcaaggaaacggaccgcatctcagcgatggcgacggagctgcgcaagctcggcgcggag
gtggaggagggggctgattacctgaaagtgacgccgccgacctccccggcaacgtggcag
accccggatgctggaattggcacctatgatgaccatcggatggccatgtgtttctcgttg
gccgcattcggcccgttgcccgtgaagatcaacgaccccggctgcgtggcaaagacgttc
cccgagtacttcgaggtatttgccggagtggcgcggtaa

DBGET integrated database retrieval system