KEGG   Cupriavidus metallidurans: Rmet_0856Help
Entry
Rmet_0856         CDS       T00351                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
rme  Cupriavidus metallidurans
Pathway
rme00230  Purine metabolism
rme01100  Metabolic pathways
Module
rme_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rmet_0856 (gmk)
Enzymes [BR:rme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Rmet_0856 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 MMR_HSR1 RsgA_GTPase ABC_tran AAA_16 AAA_22 AAA_29 Septin AAA_23 cobW AAA_18 GTP_EFTU DUF3987 Dynamin_N
Motif
Other DBs
NCBI-ProteinID: ABF07742
JGI: Rmet0856
UniProt: Q1LQ34
Position
936651..937301
Genome map
AA seq 216 aa AA seqDB search
MSETTHTAIDTAYPGNLFMVVAPSGAGKSTLVNALLAQDKAIRLSISHTTRSPRPGEQNG
REYHFISVDEFRAARDRGEFLEWAEVHGNYYATSRVWIEEQMAQGTDVLLEIDWQGAQQV
HKRFSNAVEIFILPPSLTALEERLKKRGQDEPNVIVRRLLAAGSEMSHASESDYVIINEV
FDDALKQLQNVVHATRLRFSSQKARHAELFIELGIH
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaacgacccacaccgccatcgataccgcctatccgggcaacctgttcatggtg
gtggccccgtccggggccggcaaatccacgctggtcaacgcgctgctggcgcaggacaag
gcaatccgcctgtcgatctcgcacaccacgcgcagtccgcgtcccggtgagcagaacggc
cgcgagtaccacttcatctccgtggacgagttccgcgccgcgcgcgatcggggcgaattc
ctggagtgggcggaagtgcacggcaattactacgccacgtcccgcgtctggatcgaggag
cagatggcccagggtaccgacgtgctgctggagatcgactggcagggtgcgcagcaggtg
cacaagcggttttcgaacgccgtcgagatcttcatcctgccgccgtcgctgacggcgctg
gaagaacgcctcaagaagcggggtcaggacgagcccaatgtgatcgtccgccgcttgctt
gctgcgggtagcgagatgtcgcatgcatcggagtccgattacgtgatcatcaacgaggta
ttcgatgacgcgttgaagcagctgcagaacgtcgttcatgcaacccgtttgcgcttttcg
tcgcagaaagcacggcacgccgagttgttcatcgagctcggaattcactaa

DBGET integrated database retrieval system