KEGG   Cupriavidus metallidurans: Rmet_0925Help
Entry
Rmet_0925         CDS       T00351                                 

Gene name
cbbJ2
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rme  Cupriavidus metallidurans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:rme01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rme01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rme00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rme00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:rme00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:rme00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1010940..1011677
Genome map
AA seq 245 aa AA seqDB search
MRQKLVIGNWKMHGSLAANAALLEGIKAAPARAKLAVCAPFPYLAQCQTLLSGSQVAWGA
QDVSSEARGAFTGEVAASMLGEFGCGYALVGHSERRTYHGETDAVVAAKALRALEFDIVP
VVCVGETLAEREAGQTEAVVGRQLQAVLDALSIEQLGRIVLAYEPVWAIGTGKTATSAQA
QEVHAALRARVTAKDAGVAARMAILYGGSVKPDNAAELFSMSDIDGGLIGGASLKADDFL
AIGNA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgagacaaaagctggtcatcggcaattggaagatgcatggcagcctggccgccaacgcg
gcgctgcttgagggtatcaaggctgcgcctgcgcgcgcgaagctggcggtctgcgcgccg
ttcccctatcttgcccagtgccagacgctgttgtccggttcccaggttgcctggggtgct
caggatgtgtcgtccgaggcccgtggtgccttcaccggtgaagtagctgcctcgatgctg
ggtgagtttggttgcggctatgcgctcgtcggccattcagagcgtcgtacctaccatggt
gaaaccgacgcggtagtggctgccaaggcactgcgcgcgctggaattcgacattgttccg
gtggtctgtgttggagagacgctggccgagcgcgaagccggtcagaccgaagccgtggtt
ggtcgtcagttgcaggctgtactcgatgcgttgtctatcgagcaactgggtcgcattgtt
ctggcctatgagcccgtctgggcgatcggtacgggcaagacggccacgagcgcgcaggcc
caggaagttcatgcggcgctacgtgcgcgggtcacggcgaaggatgccggtgttgcagca
cgcatggccattctgtatggcggtagcgtcaagcccgacaatgcagctgaattgttttcc
atgtccgatattgacggggggcttattggtggcgcctccctgaaggcggatgatttcctc
gcgatcggcaacgcctga

DBGET integrated database retrieval system