KEGG   Cupriavidus metallidurans: Rmet_1100Help
Entry
Rmet_1100         CDS       T00351                                 

Gene name
cysS
Definition
cysteinyl-tRNA synthetase (EC:6.1.1.16)
Orthology
K01883  
cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
rme  Cupriavidus metallidurans
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:rme00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1197120..1198538
Genome map
AA seq 472 aa AA seqDB search
MTSALSLYNSLTRKKEPLRTGQPGRVTMYVCGPTVYNFAHIGNARPAVVFDVLARLLREQ
YAEVVYARNFTDVDDKINASAAAEGVPIGTITARYIDAYHEDMRALGVLIPDLEPRVTEH
IPAIIALIQRLIANGNAYVEQDHVLFHVPSFPAYGQLSGRRPEDMLAGVRVDVAPYKRDP
LDFVLWKPSTAEVPGWPSPWGRGRPGWHIECSAMIGQHLGSTIDIHGGGQDLIFPHHENE
IAQGTCANGELYCRTWVHNSFVTVDGQKMSKSLGNVLLLRDLLGQAPGEAIRLALLSAHY
RHPLDWNAQRLLTARQTLLRFYRGLKMAEHIEISPGEEPDEEVIAALNNDLNIPGALARL
HVLLAELEKAGADASRSVAKARMMASGRLLGLFQQDPNSALRGLAGAAVTHGIATTADAA
RIDHLVAEREQARKRRDFARADALREELGAAGVLVHDTPNGSTWTLVDGTPA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgacttccgcgctcagcctctacaactcgctgacccgcaagaaggagcccttgcggacc
gggcagccgggccgcgtcacgatgtatgtctgcgggccaacggtctacaacttcgcgcat
atcggcaatgccaggccggccgttgtcttcgacgtgctggcgcggctactgcgcgagcaa
tacgcagaagtggtctacgcccgcaacttcaccgatgtggatgacaagatcaacgcgagc
gcggcggcggagggcgtacctatcggcaccattacagcgcgctatatcgatgcctaccac
gaagacatgcgcgcgctgggcgtgttgattcctgacctggagccgcgcgtcaccgagcac
atccccgcgatcattgcgttgatacagcggctgatcgcaaatgggaatgcctatgtcgaa
caggatcatgtcctgtttcacgtgccgtcctttcccgcgtatggccaactttcgggtcgc
cgacctgaggacatgcttgccggcgtgcgtgtcgacgtcgcaccgtacaagcgcgatccg
ctggactttgtcctctggaagccgtccactgccgaggttccgggctggccgagtccgtgg
ggacgcgggcgaccaggttggcatatcgaatgctcagccatgatcgggcaacacctggga
agcacgatcgacatccacgggggtggtcaggatctgatattcccgcatcacgagaatgag
attgcccagggcacttgcgcgaatggcgagttgtactgccgcacctgggttcacaacagc
ttcgttaccgtggacggtcagaagatgtccaagtcgctcggcaacgttctgctgctgcgc
gatctgctgggtcaggcgccgggggaagcgatacgactggcgctgctttcggcgcattac
cggcatcctctcgactggaacgcgcagcgtctgttgacggcgcgccagacgctgttgcgc
ttctaccgggggctgaagatggccgaacacatcgagatctcgcccggcgaagagcccgac
gaggaggtaatcgcggctctcaacaatgatctgaacattccgggtgcgctggcgcgactc
cacgtgttgctcgccgagttggaaaaggcaggtgctgatgccagccgatccgtggccaag
gcacggatgatggcgtcgggacggttgctcggattgttccagcaggatccaaactccgcg
ctccggggactggccggggcagcagtcacccatggaatcgccactactgcggacgcggca
cggatcgaccatctggtcgcggagcgcgagcaggcccgcaagcgccgcgacttcgcacgg
gcagacgcactgcgtgaggaacttggcgcggccggtgtcctggttcacgacacgcccaat
gggagtacctggacccttgtcgatggaactccagcataa

DBGET integrated database retrieval system